(data stored in ACNUC7421 zone)

EMBL: CP002355.PE319

CP002355.PE319       Location/Qualifiers
FT   CDS_pept        313031..313711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0320"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: nam:NAMH_1381 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32987"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL0"
FT                   /protein_id="ADR32987.1"
FT                   /translation="MRFGMTMIELVFAIVIIAISIVTIPSMMSVANNASKGVMIDEDVM
FT                   ERLGGWVLDKFQGRWDRNYLASGSAPLNISGMKDLNCSRTGGYRIGSDENTSSMKCNMA
FT                   ATPSVIPAVAGNNPGQADGNISRGIEQLNNGSETISITAANGTVYNVTATYSVAYVDSI
FT                   VTPLTGSNTQTATWILGSSTNMNPSSPSGNTGNTISHLKRVVTRFNNPDVNITLSFFKS
FT                   NKGN"
     atgcgttttg gaatgacgat gatcgagctg gtgtttgcta tcgtcatcat agcgatcagt        60
     atcgtaacga tcccctcgat gatgtcagtg gccaacaatg cttcaaaagg ggttatgatc       120
     gacgaagacg tgatggaacg tttgggcgga tgggtattgg acaagtttca gggacggtgg       180
     gacagaaact atctggcttc tggatcggct cctctcaata ttagcggtat gaaagacttg       240
     aactgctctc gaaccggtgg atatcggatc gggtcggatg aaaacacgtc atcaatgaag       300
     tgtaacatgg cggcaactcc atctgtcatt ccggcggtag caggaaataa tcctggacaa       360
     gcagacggta atatttcccg ggggattgaa cagcttaata atggaagcga gacgatttca       420
     atcactgcgg cgaacggaac agtatacaat gttacggcaa cgtacagcgt agcatacgtc       480
     gattctattg taacgccgtt aacgggaagc aatacccaaa cggctacgtg gatactggga       540
     tcatctacta atatgaatcc ctctagccca tccgggaata caggaaatac gataagccat       600
     ttgaaacgtg ttgttacacg gtttaacaac ccggatgtaa atataaccct ctcgtttttc       660
     aaatcgaaca aaggcaatta g                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page