(data stored in ACNUC7421 zone)

EMBL: CP002355.PE32

CP002355.PE32        Location/Qualifiers
FT   CDS_pept        complement(32819..33646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0032"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   ant:Arnit_1848 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Periplasmic binding
FT                   protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32700"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW84"
FT                   /protein_id="ADR32700.1"
FT                   /translation="MLLKLWALLIVGMNLYGTERIIALSPAINETLYALGAGDQIIANT
FT                   EYCNYPVEAKNKPKVGGYFSPSLEKILSLNPTMVILQENNAPLAAKIQKMGIKTLIIKI
FT                   DTYPSIRRSIFTIGAVVHKEKRAEAIVSELDQKLRALRGIIRNQKILMVFGHNTDLSKS
FT                   IYVSGQNLYFDDLIRSSGNTNALQSRRKGQPVLNLENIIALNPDVIILLAPNTKERGLT
FT                   KEALIAPWRSLPINAAKREKIYVEDQPYSSNPSQRLGLFLDDMRGYLIDAARR"
     atgctattga aactctgggc tctattgatc gtgggtatga acctttacgg tactgagcgg        60
     atcatcgcac tcagccccgc catcaacgaa actctgtatg ccctgggtgc gggagatcag       120
     atcattgcca atacggagta ttgcaattat cccgttgagg ccaaaaataa acccaaggtg       180
     gggggatatt tctcaccatc tctggaaaag attctctccc tcaaccccac gatggtgatc       240
     ctgcaggaaa acaatgctcc tctggcggca aaaattcaaa agatggggat caaaacactc       300
     atcattaaaa tcgataccta cccctcgatt cgccgatcga tctttaccat cggcgccgtc       360
     gttcacaaag aaaagagggc tgaagccatc gtgagcgaac tcgatcaaaa actccgtgcc       420
     ctgcggggga ttatacgcaa tcaaaagatt ttgatggtgt tcggacacaa taccgatctc       480
     tccaaaagca tctatgtctc ggggcagaac ctctattttg acgatctcat ccgttccagc       540
     ggtaatacta atgcgcttca aagccgtcga aaggggcagc cggttcttaa tctcgaaaac       600
     attatcgcgc tcaaccctga tgtcatcata ctgctagccc cgaataccaa agagagaggg       660
     ttaacgaaag aggctttgat agcaccgtgg cgttctcttc cgattaatgc ggccaaacgg       720
     gaaaaaattt atgtcgaaga tcagccctat tcgagtaacc cgagccagcg tctcggcctt       780
     tttttagatg atatgagggg gtatttgatt gatgctgcac gtcgctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page