(data stored in ACNUC7421 zone)

EMBL: CP002355.PE320

CP002355.PE320       Location/Qualifiers
FT   CDS_pept        313712..314650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0321"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: sdl:Sdel_0855 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32988"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL1"
FT                   /protein_id="ADR32988.1"
FT                   /translation="MKSKRSAFTMIELLFVIVILGIVGGFALEAVRQYYDGIYRTQQYT
FT                   QRAAEADQILEQISKYFENGISSSIVNLDRGGAAAACYGPPVSGDNNDYTVAFIGVDED
FT                   SIRGIGGRPGWSEETVLGANNTLTALDANYTAADTIIQALSLNNGSDLSHSAIYDAGSV
FT                   DLDTCTRFNWNLLGGTGGYHRMDNVANPISSTVIQLNDDNNATDGHRKYLLRTGYAFRV
FT                   NNGNFTMYSNFRPWLGERYTAAQNQNILGQNVAHFYADYNATDFQNDSNVSDRGLVWRL
FT                   KVCIRGLDSSLNDTDARESQICRERRVHVRY"
     atgaagtcta aacgatccgc atttacgatg attgaattac tttttgtcat tgtgattttg        60
     ggcatcgtgg gtggattcgc actcgaagcg gttcgccaat attatgatgg gatataccgt       120
     acgcagcagt acacccaaag ggctgcagag gccgatcaga tattggagca gatttcaaaa       180
     tactttgaaa atggtatcag cagctctatt gtcaatcttg atcggggtgg tgccgcagcg       240
     gcttgttatg gtcctcccgt cagtggcgac aataacgatt atactgtcgc ctttatcgga       300
     gttgatgaag acagtatacg cggaatagga gggcgtcccg gatggagcga agagaccgta       360
     ttgggtgcca ataatacgct aacggctttg gatgccaatt ataccgctgc cgatacgatt       420
     attcaggcac ttagtcttaa taacggttcg gatttaagtc attccgctat ttatgatgcc       480
     ggtagtgtcg atctcgacac ttgtacacgc tttaactgga atttgttggg tggaacaggt       540
     ggctatcaca ggatggataa tgttgccaat ccgatttcat caaccgtgat acaactcaat       600
     gatgataaca atgcgacgga cggacatcgc aaatatctgc ttcggacggg gtacgcattt       660
     cgggtaaata acggcaactt tacgatgtac agtaacttcc gtccgtggtt gggcgaacgt       720
     tatactgcgg cacaaaatca aaatatattg ggtcaaaatg tcgcccattt ttatgccgat       780
     tacaacgcaa ccgattttca aaacgattcc aatgtttcag acagaggttt ggtatggagg       840
     ctaaaggttt gtatacgcgg tttggacagt tcattaaacg atacggatgc gcgtgaatca       900
     cagatttgtc gtgaaaggag agtgcatgta cgctactaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page