(data stored in ACNUC7421 zone)

EMBL: CP002355.PE322

CP002355.PE322       Location/Qualifiers
FT   CDS_pept        complement(315135..315512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0323"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG3437 Response regulator containing a
FT                   CheY-like receiver domain and an HD-GYP domain; InterPro
FT                   IPR001789; KEGG: tdn:Suden_0415 response regulator receiver
FT                   domain-containing protein; PFAM: response regulator
FT                   receiver; SMART: response regulator receiver; SPTR:
FT                   Response regulator receiver domain protein; PFAM: Response
FT                   regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32990"
FT                   /db_xref="GOA:E4TYL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL3"
FT                   /protein_id="ADR32990.1"
FT                   /translation="MDEKKLKVLAVDDDLINLKLLKTMLMKTPNVSAVVEAKNGADAIG
FT                   ILKTQNDIDIILLDIIMPVMGGIEMLKVIRADESLRQLPVIVLTTDETKKGEALECGAN
FT                   GFLMKPVREKDVLTKIAQLAF"
     atggatgaga agaaactaaa agttcttgcc gttgatgatg atcttattaa cctcaagctg        60
     ctaaaaacga tgttgatgaa aaccccgaat gtttctgctg tcgtagaagc aaaaaacggt       120
     gccgatgcga tcggtatcct aaaaacgcag aatgacatcg atattatcct tctcgatatt       180
     atcatgccgg tgatgggtgg aattgaaatg cttaaagtga tacgcgccga cgaatcgctc       240
     cgacagctcc ccgtcatcgt cctcaccacc gatgaaacca aaaaagggga agccttggag       300
     tgcggtgcaa acggattttt gatgaaaccg gtccgcgaaa aagatgtcct caccaaaatt       360
     gcccaactcg cattttaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page