(data stored in ACNUC7421 zone)

EMBL: CP002355.PE323

CP002355.PE323       Location/Qualifiers
FT   CDS_pept        complement(315532..318798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0324"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR003661: IPR003594: IPR001789: IPR004358: IPR
FT                   005467; KEGG: tdn:Suden_0416 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; SPTR:
FT                   Nitrate and nitrite sensing family; PFAM: Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; Nitrate and
FT                   nitrite sensing; Response regulator receiver domain; His
FT                   Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32991"
FT                   /db_xref="GOA:E4TYL4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL4"
FT                   /protein_id="ADR32991.1"
FT                   /translation="MQLGLRNRLRLISLLPILILFTLASYYVYNAYISYKGAEELQIRL
FT                   EGNKQLNDLINNLSRERGMTVMYMGNASPATLKSLHAQRAIVDQKIGIYQEHLARLEHT
FT                   NGPEAAKAAALSKLIVDLERGITQSRPLVDGGTANFDKIFTDLYSKSEEQLINELTDLA
FT                   TIHFDEEVNSLSSSYLSLVRANEYSSIERDYITYVLSRATPLAEEELNKWVSLIAKADT
FT                   FNLEGMNNKPIQSKLQASLYSEDNTDLFLDITTERTAILQASTTGKYETQSGIWFAMIS
FT                   EKIDAINDAEKILIDAMDERASIVKSQAVQVLAIAISIWILGVIIAILGYFFSAEITTN
FT                   IKNLESVLKRVAEDTHDNEAEALRHTINLDTAAGTAQAYALLERIIEQTLNDKQYAMEA
FT                   SEAKSMFLANMSHEIRTPLNGIVGFTELLKDTELHDEQREFIDIIEKSSENLLEIINNI
FT                   LDLSKIESNKLEIEEIVFNPIDEFESAVEVYGVRASEKHIDLACYVDPSLERPLKGDPT
FT                   KIKEVIINLLSNAVKFTNSGGAISVDIRRIECEILNRTRIRFQVKDNGIGVTSEQRSRI
FT                   FEAFSQADTSITRKYGGTGLGLTISSRFVELMGSKLDLESEPGNGTSFFFTLEFEEIET
FT                   LNESLKGSFSNINAVILENHSKKKLQNTYLKEYLDYFGVSYTTFHEQSELKMLERQVNY
FT                   DLLFVDNDYTNDEEMAAYASSQEQLVLITKSFYMKKIDSMGIDIFKVLYEPLNSSKIRT
FT                   TLDAYDAEAFSNRKIKVSRRKKFDEKNSRFAATALVAEDNIINQKLIRRTLEDLGLEIT
FT                   IANNGLEAFEKRKNGSFDIIFMDIQMPVLDGIEATQEILDFEEDYGQNHIPIIALTANA
FT                   LKGDRERFMSAGMDEYTTKPLVRSEIISLLNNFLSHKIVEINPVPKSIHEIAAPSEESL
FT                   PLSSEPDIQPEVHEEPVHDSEFPILSEEVESSEPAEEEGLVEYDADILIAKQNALESKL
FT                   FCHILNDLGYTYKSVASADQLKDELHNRHYKLVMFDKTLSGLHLKDLYDIIHTKKSDTS
FT                   IVMLIDPNVSEEADDAMYVHEIIKNIINKDLLRLVFEKFI"
     atgcaactag gactaagaaa tcgacttcgc ctcatcagtc tcttaccgat cctgatactt        60
     tttacccttg cgagttacta cgtttataat gcgtatatca gctacaaagg ggcagaagaa       120
     ctacaaatac ggttagaggg gaataaacaa cttaatgact tgattaacaa cctttcccga       180
     gaacgcggaa tgaccgttat gtatatgggc aacgcttcac ccgcaactct caaatccctt       240
     catgcccaac gggccattgt tgaccaaaaa atcgggattt atcaagagca tcttgcacgt       300
     cttgaacata cgaacgggcc tgaagcggca aaagctgccg ctttatcaaa actcatagtt       360
     gatctggaac gcggtatcac tcaatcaagg cctttagtcg atggcggtac cgctaatttc       420
     gataaaattt ttaccgattt gtacagcaaa tccgaagagc agcttatcaa tgagctaacc       480
     gaccttgcga ccatccactt tgatgaagag gtcaactccc tctcatccag ctatctctca       540
     ttggtacgtg caaacgaata cagcagtatc gagcgtgact acatcaccta tgtcctctca       600
     cgtgcgactc cgctggccga agaagaactg aacaaatggg tttcactgat tgccaaagcc       660
     gataccttca atcttgaggg aatgaataac aaaccgatcc aatcaaaact tcaagcatct       720
     ctctacagtg aagacaacac cgaccttttt cttgacataa cgaccgaacg taccgcgatt       780
     ctgcaagcca gtacaaccgg aaaatacgaa acgcaatcgg gtatttggtt tgcaatgatt       840
     tctgaaaaaa tcgatgcgat taatgatgcc gaaaaaattc tgatcgatgc gatggatgag       900
     cgcgcttcca ttgtcaaaag ccaagcggtt caagtccttg ccatcgccat ctctatttgg       960
     atactcggag ttatcatcgc cattttgggt tacttctttt cggctgagat cacaaccaat      1020
     attaaaaacc tcgaatcggt tttaaaacgg gttgccgaag acacccatga caatgaagcc      1080
     gaagccttaa gacacaccat caatcttgac acggcggcag gaacggcgca ggcatatgcg      1140
     ctactggaac ggattatcga acagacgttg aacgataaac aatacgcgat ggaagcgtct      1200
     gaagccaaat caatgttttt ggccaatatg tcccatgaaa tccgtactcc gctgaacgga      1260
     atcgtcggat ttaccgaact tcttaaagat accgaactgc atgatgagca gcgcgaattc      1320
     atcgatatca ttgaaaaaag ttccgagaat cttctcgaaa tcatcaataa tatccttgac      1380
     ctctcaaaaa tcgaaagcaa taagctcgaa atcgaagaga ttgtctttaa tccgattgac      1440
     gaatttgaaa gtgccgttga agtgtacggt gtacgtgctt ccgaaaaaca tatcgatctt      1500
     gcctgttacg tcgatccgag tttggaacgg ccgctcaaag gggatccgac caaaatcaaa      1560
     gaggttatca tcaacctcct tagcaatgcg gtcaaattta ccaacagcgg cggagctatc      1620
     agtgtcgata tccgacgtat agagtgcgag attcttaacc ggacacgtat ccgtttccaa      1680
     gtcaaagaca acggtatagg tgtgaccagt gagcagcgtt cgcgcatttt cgaagctttc      1740
     tcccaagccg atacctctat tacccgcaaa tacggcggta cggggctggg tctgacaatt      1800
     tcaagccgtt ttgtcgaatt gatgggaagt aaactcgatc ttgaaagcga gccaggcaac      1860
     ggcaccagct tcttttttac cctagagttt gaagagattg aaacactcaa cgaatcgctt      1920
     aaaggatctt tttccaatat taatgcagtc attttggaaa atcattcgaa gaaaaaactc      1980
     caaaatacct atcttaaaga gtaccttgac tactttggag tcagctacac aacgtttcat      2040
     gagcagagtg aactcaaaat gctcgaacgt caagttaatt atgatctgct gtttgtagat      2100
     aatgactata ccaacgatga ggagatggct gcttacgcat cgtcccaaga gcagctggta      2160
     ctcattacca aatcgtttta tatgaaaaaa atcgattcga tggggatcga tattttcaaa      2220
     gtgctgtacg aaccgttgaa cagctccaaa attcggacta ccctcgatgc ctatgatgcg      2280
     gaagcattca gtaaccgcaa aatcaaagtt tcacgccgca aaaaattcga tgagaaaaat      2340
     tcccgctttg cggcaaccgc acttgtggct gaagataata tcatcaacca aaaactgatc      2400
     cgtcgaacac tcgaagatct cggactggaa attacaattg ccaacaacgg tcttgaagcg      2460
     tttgaaaaac gtaaaaacgg cagttttgac atcatattta tggatattca gatgccggtt      2520
     cttgacggta tcgaagcgac tcaggagatt ttagatttcg aagaggatta cggacaaaac      2580
     catattccga tcatcgctct gaccgccaat gctctcaaag gggatcgtga acggtttatg      2640
     agtgcaggga tggacgaata cacaaccaaa cctctggtac gttcggaaat catctcgttg      2700
     ctcaacaact tcctctctca taaaattgtt gaaatcaatc ccgttccaaa atcaatccat      2760
     gagattgcag ctccgtctga agaatcgctg cctctgtcga gcgaacctga cattcagccc      2820
     gaggtacacg aagaacccgt tcatgattcc gaatttccga ttttatcaga agaagtagaa      2880
     tcatcggaac ctgcggagga agaaggtctc gtagaatacg atgccgatat tctgattgct      2940
     aaacaaaatg cccttgaatc aaaactcttt tgccatatcc ttaacgatct ggggtatacc      3000
     tataaaagtg tagcctctgc agatcagctc aaagacgagc ttcacaatcg tcactataaa      3060
     ctcgttatgt ttgataaaac gctaagcggc ttacatctca aggatctgta tgatataatc      3120
     catactaaga aaagtgatac ttctatcgtt atgctgattg atccaaatgt ttcagaagaa      3180
     gctgatgacg caatgtatgt tcacgaaatt atcaaaaaca ttatcaacaa agatcttttg      3240
     cgtcttgttt ttgaaaaatt tatctaa                                          3267
//

If you have problems or comments...

PBIL Back to PBIL home page