(data stored in ACNUC7421 zone)

EMBL: CP002355.PE324

CP002355.PE324       Location/Qualifiers
FT   CDS_pept        complement(318824..320602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0325"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008207; KEGG: nis:NIS_1344 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32992"
FT                   /db_xref="GOA:E4TYL5"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL5"
FT                   /protein_id="ADR32992.1"
FT                   /translation="MLFYNHKQEFIGIDAEGLKLLNYATLEDLLKVCDDVADLFSKEPG
FT                   YIHNFKSFGWIDFLLHADSDARSAIVHGNGRTFSCTLQVNDLFLCDDPSASGYIIDMLH
FT                   IQSLSGDEIKPHSIPPKAKSDSRPPVFETPIPAETAPSVLPNYDHITPTPLSEPGVLDV
FT                   PSYSEQEVEEEPIEDLFTKLSLQHDDEDLETKYVIPESTFSDKSDIKAEQEVPHQISEA
FT                   VSFSKAEKEFIDALKVDKSYRFDPNVAAQELGLPVDLIQEFIGDFIQQAHEFKEELFEV
FT                   VLKGDMNNLKILSHKLKGVAANLRIEDAFETLSNINTSNDPVEIEANLKYFYSIISKLE
FT                   GKESPAAATDETANDEEFLLPPEKAFDFSEDEPSSPPDDDIYAFDFKNDAFAVPEEERT
FT                   PASSADEDFDDISFPSEAVLDQEISAESARDDDIYTFDLKDDHEPFVMEEAVQTSSENK
FT                   EVPTYLLEEKSIEEEPLPIEESNLEESSPAVEPPQTLHFDKISIAGQLGIQLDFFDELI
FT                   EEYKRDSLRAGSEISAAISAFDTHAWKKTAGQLKGISDNLRLNEISDELAILSQTNDAQ
FT                   EANKASKRLNSFLEQL"
     gtgctatttt ataaccataa acaggaattt atcggaatcg atgcagaggg actcaaactc        60
     ttaaattatg caacattgga agatttgcta aaggtatgcg atgacgtagc agacctattt       120
     tccaaagaac ccggatatat tcacaatttt aaaagtttcg gatggataga ttttttgctt       180
     catgccgact ccgatgcacg ctcagccatt gttcatggta acggtcgcac cttttcgtgt       240
     actttgcagg taaatgacct ttttttatgt gacgatccct ctgcttccgg ctatatcatc       300
     gatatgctcc atattcaatc gctcagcgga gatgaaatca agcctcacag cattcctcca       360
     aaagcaaaat cggatagtag acctccggtt tttgaaactc ctattcctgc tgagacggca       420
     ccttccgtct taccgaatta cgatcatatc accccgaccc cgctcagtga gccgggagtt       480
     ctcgatgttc cttcatacag cgaacaggaa gtcgaagaag aaccgattga agatttattt       540
     acaaaactat cgcttcagca tgacgatgaa gatttggaaa caaaatatgt gattccggaa       600
     tcgaccttct ctgacaagtc tgatattaaa gccgaacagg aagttccgca tcaaatatct       660
     gaagccgtca gttttagcaa ggcggaaaaa gagtttattg atgccttaaa ggttgacaaa       720
     tcataccgct ttgatccgaa tgttgccgct caagagctcg gtttgcctgt cgatttgatc       780
     caagagttta tcggcgactt tatccaacaa gcccatgagt ttaaagaaga acttttcgaa       840
     gtggttctga aaggggacat gaacaatcta aaaatactgt cccataaact caaaggggta       900
     gcggcaaatc tccgtatcga agacgctttt gaaacactca gcaatatcaa tacatcgaac       960
     gatccggtcg aaattgaggc caacctcaaa tatttttaca gcattatttc aaaattggaa      1020
     gggaaagaga gtcccgcagc ggcaaccgat gaaacggcta acgatgagga gttccttctc      1080
     cctcctgaga aagcgtttga cttttcagaa gacgagccgt ccagcccgcc tgatgatgat      1140
     atttatgcat ttgatttcaa aaatgatgcg tttgcggtac cggaagaaga acgcactccg      1200
     gcctcttcgg cggatgaaga ttttgacgat atttcgtttc cttcagaagc cgttcttgat      1260
     caagaaatat ccgcggaatc tgcccgagac gatgacattt acactttcga tttaaaagac      1320
     gatcatgaac cgttcgtaat ggaagaagcg gttcaaacgt cttccgaaaa taaagaggtc      1380
     ccgacatatc ttttagaaga aaagtcaatt gaggaagagc ctctgccgat tgaagagagc      1440
     aatctagagg aaagcagccc ggcagtagaa cctccgcaaa ctcttcactt tgacaaaata      1500
     tctattgccg gtcagttggg cattcaactt gactttttcg acgaattgat cgaagaatat      1560
     aaacgtgatt ccctccgtgc cggaagcgag atcagtgccg ctatcagtgc attcgacacc      1620
     catgcctgga aaaaaacggc cggtcagctt aaagggatca gcgacaatct gagattgaat      1680
     gaaatttccg atgaattggc aatcttgtcc caaacaaacg atgcgcagga agcaaacaaa      1740
     gcttcaaaac ggctcaatag ctttcttgaa caattataa                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page