(data stored in ACNUC7421 zone)

EMBL: CP002355.PE325

CP002355.PE325       Location/Qualifiers
FT   CDS_pept        complement(320612..321028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0326"
FT                   /product="PAS sensor protein"
FT                   /note="InterPro IPR000014: IPR013655: IPR001610: IPR000700;
FT                   KEGG: sun:SUN_1902 signal transduction sensor histidine
FT                   kinase; PFAM: PAS fold-3 domain protein; SMART: PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   SPTR: Methyl-accepting chemotaxis sensory transducer with
FT                   Pas/Pac sensor; TIGRFAM: PAS sensor protein; PFAM: PAS
FT                   fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32993"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL6"
FT                   /protein_id="ADR32993.1"
FT                   /translation="MMQKPTPVDEEYLFDGRAIVSETDLKGVITFANRKFCEISGYTVN
FT                   ELIGEPHNIIRHPDMPKAAFAQMWQTIQSGALWHGLVKNLRKDGRYYWVDTEVTPIYDE
FT                   NGKVKGYMAARKPASRKNIEETAALYQKMIEQEQ"
     atgatgcaaa aacctactcc agtggatgaa gagtacttat tcgatggacg cgcaattgtc        60
     agtgaaacgg atcttaaagg ggtcataaca tttgccaatc gaaaattctg tgaaatttca       120
     ggctataccg tcaatgaact gataggtgaa cctcacaata tcatacgcca ccccgacatg       180
     cccaaagcag cattcgctca aatgtggcaa acgattcaat cgggagctct atggcacggt       240
     ttggtcaaaa atctccgcaa agacgggcga tactattggg tagatactga agtgactccc       300
     atttacgatg aaaacggaaa agttaaagga tatatggcgg cacgcaaacc ggcgtcacgc       360
     aaaaatattg aagagaccgc ggcactctac caaaaaatga ttgagcaaga gcaataa          417
//

If you have problems or comments...

PBIL Back to PBIL home page