(data stored in ACNUC7421 zone)

EMBL: CP002355.PE326

CP002355.PE326       Location/Qualifiers
FT   CDS_pept        complement(321096..322904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0327"
FT                   /product="Excinuclease ABC subunit C"
FT                   /note="COGs: COG0322 Nuclease subunit of the excinuclease
FT                   complex; InterPro IPR004791: IPR000305: IPR001943:
FT                   IPR001162; KEGG: tdn:Suden_0418 excinuclease ABC subunit C;
FT                   PFAM: excinuclease ABC C subunit domain protein;
FT                   Excinuclease ABC C subunit domain protein; UvrB/UvrC
FT                   protein; SMART: Excinuclease ABC C subunit domain protein;
FT                   SPTR: UvrABC system protein C; TIGRFAM: excinuclease ABC, C
FT                   subunit; PFAM: UvrB/uvrC motif; UvrC Helix-hairpin-helix
FT                   N-terminal; GIY-YIG catalytic domain; TIGRFAM: excinuclease
FT                   ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32994"
FT                   /db_xref="GOA:E4TYL7"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL7"
FT                   /protein_id="ADR32994.1"
FT                   /translation="MIEQIRGLPHQAGIYQYLDEKGRILYIGKAKNLSKRVKSYFNLTP
FT                   SLSPKATLSLRIQKMLSETVGLHYIIVENEHDALILENSLIKQLKPKYNILLRDDKTYP
FT                   YLYVDMDETYPRFELTRKIIKGKSIRYFGPFSVGARDILDSLYELLKLVQKKSCLKGKK
FT                   GCLFYQMEQCLAPCEFPIPHETYLPMVTQGIEWIQNKRKLIKQLEAKMEFYAESLRFEE
FT                   ALVLRDRIDRITKSELTSQIDLASTENYDVFAIALNEVRACILRLFIREGKVASSTHDF
FT                   IPITPYFSIDEAYERTLIGFYGNEKPPIIAPILTAHPFESNDWVQEHLTELFGKKAKIE
FT                   TPQRGAKKELIDLALTNAKELLRTPQPTNEHLLHSIQELLALDSLPRRIEVFDNSHHGG
FT                   SATVGAMIVYENGRFDKKAYRTYHLHERDEYGQMREMLTRRIEAFEKNPPPDLWVLDGG
FT                   ATLRSLATDLLGSHGIHLDVIAISKEKIDAKAHRAKGSARDILHFAEEPLRLESSDKRL
FT                   QFIQMLRDEAHRSAITFHKKTKLKIDQTSKLLAIHGISTPKIHRLLDYFGTFDAIAKSD
FT                   FKTLSELIGAKDAENIQKYYRGNISK"
     atgatagagc aaattcgggg tctcccgcat caagcgggga tctatcaata tttggatgag        60
     aaagggagga ttctctatat cggaaaagcc aaaaacctct ccaagcgggt caaaagttat       120
     ttcaatctta ccccttcact cagcccgaaa gcgaccctct ctttacgcat tcaaaaaatg       180
     ctctccgaga cagtagggct gcactatatt attgtcgaaa acgagcacga tgccctcata       240
     ttagaaaatt ctcttattaa acagctcaaa cccaaataca atattttgct gcgcgatgat       300
     aaaacctacc cttatctcta cgtcgatatg gatgagacat atccccgttt cgaactcacc       360
     cgcaaaataa tcaaagggaa atcgatccgc tatttcggcc ctttttcggt gggggcgcgt       420
     gatattctcg actcgcttta cgaactgctc aaactggttc agaaaaaaag ttgcctaaaa       480
     gggaaaaaag ggtgcctttt ttaccaaatg gaacaatgtc ttgccccatg cgagtttcca       540
     atccctcatg aaacctatct gccaatggtg actcagggga tcgaatggat ccaaaataaa       600
     cgtaaactga ttaagcagct cgaagcaaaa atggaatttt atgccgaatc gctccgcttt       660
     gaagaagcac tcgtcttacg ggaccggatt gatcgaatta ccaaaagcga actaacgtct       720
     caaatcgatc tggcatccac agaaaattac gatgtattcg ccattgcgct gaacgaagta       780
     cgtgcctgca tactccgcct ttttatccgt gagggcaaag tagcgtcttc aacccacgac       840
     tttatcccga tcacccctta tttctcgatt gatgaagcat atgagcgaac cttgatcgga       900
     ttttacggaa atgaaaaacc tccgatcatt gcccccatat tgacagcaca cccgtttgaa       960
     tcgaacgatt gggtgcagga acatctcaca gaacttttcg gcaagaaagc caaaattgaa      1020
     acgcctcagc gcggagccaa aaaagagctg atcgatttag ccctcaccaa tgccaaagaa      1080
     ctgctgcgta caccgcagcc tacgaatgaa catctccttc actctatcca agagctgcta      1140
     gcccttgact ctctcccgag acggattgag gtgtttgaca attcccacca cggcggttca      1200
     gccaccgtag gcgctatgat cgtctatgag aacggccgtt ttgacaaaaa agcttaccgt      1260
     acctatcatc ttcatgagcg agatgaatac gggcaaatga gagagatgct cacacgccgc      1320
     atcgaagcct ttgagaaaaa tccgccgccc gatttgtggg tgctggacgg aggagcgaca      1380
     ttgagatccc tcgcgaccga tctgctcggt tcgcacggta tccatctcga cgttatcgcc      1440
     atcagtaaag aaaaaatcga tgccaaagct catcgggcca aaggttccgc ccgcgatata      1500
     ctccattttg cagaagagcc tttgcgtctc gaaagctcgg acaaacgtct tcaatttatc      1560
     caaatgctcc gtgacgaagc ccaccgaagt gccattacct ttcacaaaaa aacaaagctc      1620
     aaaatcgatc aaacctcaaa acttttagcg attcacggta tcagcacacc gaaaattcat      1680
     cggcttcttg attatttcgg aacatttgac gccattgcaa aaagtgattt taaaaccctt      1740
     tccgagctta tcggcgcaaa agatgccgaa aatatccaaa aatattacag aggtaacata      1800
     tctaagtaa                                                              1809
//

If you have problems or comments...

PBIL Back to PBIL home page