(data stored in ACNUC7421 zone)

EMBL: CP002355.PE328

CP002355.PE328       Location/Qualifiers
FT   CDS_pept        323089..324531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0329"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="COGs: COG0029 Aspartate oxidase; InterPro IPR005288:
FT                   IPR003953: IPR004112; KEGG: tdn:Suden_0420 L-aspartate
FT                   oxidase; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; SPTR: L-aspartate oxidase;
FT                   TIGRFAM: L-aspartate oxidase; PFAM: domain; FAD binding
FT                   domain; TIGRFAM: L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32996"
FT                   /db_xref="GOA:E4TYL9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL9"
FT                   /protein_id="ADR32996.1"
FT                   /translation="MRYDVVIIGSGVAGLYAAIALPKNLKVLIINKSNPWECNTYYAQG
FT                   GVTTAYNDQDIPSHVQDTLDAGAGMCNATAVQFMSESSQGVIRDLIERGFEFDKDDEGH
FT                   LLYTKEAAHSRSRILHAGGDATGRHLHFFLLNQNSHPMLSDATVVDLLIENNQCCGVEV
FT                   FSEGKRKTILSDNVIIASGGVGSLYEFHTNASTISGDLHGICIEKGIELESMEMMQFHP
FT                   TVFVANDWARKQLLSEALRGEGAHVVDENGYRFLFEYDPRGELAPRDIVSRAIFDYRQR
FT                   SGKQVYLSCEDFESEYFKERFPNIYKSLNDLGFHLPKERVPISPAFHYAVGGIKTNLDG
FT                   SVPGISGLYAAGEAASTGVHGANRLASNSLLEGLVFSKKAAESILEHPLHSCSGDFCIG
FT                   DEPLEIEGDKEKKDRLRRIMWENVSIKRTPDGLNAAYEAINEMLEGEVGRLLKLRLLTA
FT                   QSIVASAQKRTESIGVHYIVEG"
     ttgcgttatg atgtcgtgat tatcggttcg ggggttgccg gcttgtatgc ggcgatcgca        60
     ttgccgaaaa atttaaaagt attaatcatc aataaatcga acccgtggga gtgcaatacc       120
     tattatgcac aaggcggcgt aacgacggcc tacaatgatc aggatatccc ctctcacgta       180
     caagataccc tggatgcggg ggcaggaatg tgcaacgcaa ccgctgtaca gttcatgagc       240
     gaaagctcgc agggagtaat ccgtgatctg attgagcgcg ggtttgagtt tgataaagac       300
     gatgagggac atttgctcta tacgaaagag gcagcccatt cgcgcagccg gatccttcat       360
     gccggagggg atgcgacggg tagacacctt catttctttt tgctcaacca aaattcccac       420
     ccgatgctca gtgatgcgac ggttgttgat ttgctgattg agaacaacca atgttgcggt       480
     gtggaagtgt ttagcgaggg gaaacgcaaa acgattctct cagataatgt cattattgcc       540
     agcggcggag tgggatcgct gtatgaattt cacacgaatg cctctacgat cagtggggac       600
     cttcacggca tctgtatcga aaaagggatt gaactcgaat cgatggagat gatgcagttt       660
     catcccaccg tatttgtcgc caatgactgg gcgcgtaaac agctcctatc cgaagcgctc       720
     agaggtgagg gagcgcatgt cgttgatgaa aacggctatc gctttttatt cgaatacgat       780
     cctcgcggag agttggcacc ccgtgatatc gtcagccgtg ctatttttga ttaccgccag       840
     cgtagcggca aacaggttta tctttcatgt gaggattttg agagcgaata ttttaaagag       900
     cgtttcccga atatttataa atcactcaat gatctcggat ttcatcttcc taaagagagg       960
     gttccgattt ctcccgcttt tcactatgcc gtcggaggaa tcaaaacgaa tcttgatgga      1020
     agcgttccgg gcataagtgg gctttatgcc gcaggagaag cggcttcgac cggagtacac      1080
     ggggcaaatc gtctggcaag caactcgcta ttggaaggtt tggttttttc aaaaaaagcg      1140
     gcagagtcga ttcttgaaca tccgcttcac agttgcagcg gagatttctg tatcggtgat      1200
     gagccgttag aaatagaagg ggacaaagag aaaaaagatc gtttacgacg gattatgtgg      1260
     gaaaatgtct cgatcaaacg gactcccgat ggtttgaacg cggcgtatga agcgatcaat      1320
     gagatgcttg agggtgaagt aggaagactg ttgaaattgc gtttgttaac agctcaaagc      1380
     atagtggctt cagcacaaaa gagaactgag tcgatcggag ttcactatat tgtcgagggt      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page