(data stored in ACNUC7421 zone)

EMBL: CP002355.PE33

CP002355.PE33        Location/Qualifiers
FT   CDS_pept        complement(33637..33981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abi:Aboo_1244 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32701"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW85"
FT                   /protein_id="ADR32701.1"
FT                   /translation="MKLIVLSVFLALHCWGENLTVTLHYGDAKPDKVIETAYSRGMSAL
FT                   DVLKRISRVETSKTGQYRFVRSIDGVRSQIGKFGWFYLIDGESVNTTAENFILNDAKTM
FT                   TWIYKVEACY"
     atgaaactca ttgtactatc tgttttttta gcactgcatt gttgggggga gaatcttacg        60
     gttaccctcc attacggcga tgcaaaaccc gataaagtca tcgaaacggc ctattcgcgg       120
     ggaatgagcg cattggacgt tcttaaacgg atcagtcgtg tagagacgag caaaacggga       180
     cagtaccgtt tcgtccgttc catcgacggt gttcgatcgc agatcggcaa attcggatgg       240
     ttttatctca ttgacggaga atcggttaat acaacggcgg agaatttcat tttgaacgat       300
     gctaaaacca tgacatggat ttacaaggta gaagcatgct attga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page