(data stored in ACNUC7421 zone)

EMBL: CP002355.PE330

CP002355.PE330       Location/Qualifiers
FT   CDS_pept        326266..327810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0331"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="COGs: COG0519 GMP synthase PP-ATPase domain/subunit;
FT                   InterProIPR004739: IPR001674: IPR000991: IPR011702: IPR
FT                   001317: IPR006220: IPR017926; KEGG: tdn:Suden_0422 GMP
FT                   synthase; PFAM: GMP synthase domain protein; glutamine
FT                   amidotransferase class-I; SPTR: GMP synthase; TIGRFAM: GMP
FT                   synthase, large subunit; GMP synthase, small subunit;
FT                   manually curated; PFAM: Glutamine amidotransferase class-I;
FT                   GMP synthase C terminal domain; tRNA methyl transferase;
FT                   TIGRFAM: GMP synthase (glutamine-hydrolyzing), C-terminal
FT                   domain or B subunit; GMP synthase (glutamine-hydrolyzing),
FT                   N-terminal domain or A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32998"
FT                   /db_xref="GOA:E4TYM1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYM1"
FT                   /protein_id="ADR32998.1"
FT                   /translation="MKDVNIIVLDFGSQYTQLIARRLREDKVYCEVLPYHTKIDAIKAK
FT                   NPKGIILSGGPSSVYNKDAYEVDQGVYALGIPVLGICYGMQRIAVDFGGSVIRSDHHEY
FT                   GKAELTIDMTQHSVLFEGCEDERTVWMSHSDKVDVLPEGFVPIAYSPNSPYAAIANEEK
FT                   MVYAMQYHPEVNHSEEGYLMLRNFARKICGITEKWDMGHFLKEQIVKIRAQVGEGKVLC
FT                   ALSGGVDSSVVAALLYEAIGDQLIPVFVDNGLLRKGERESVENIFKVHLKVPLVVADAS
FT                   EIFLGKLAGVTDPETKRKIIGHTFIEVFEAEAKKHDGIKFLAQGTLYPDVIESVSVNGP
FT                   SVTIKSHHNVGGLPDWMDFELIEPLRDLFKDEVRKLGLELGLPDSLVNRHPFPGPGLGI
FT                   RIMGEVNKPDLNLLREADAILLDELKASGYYTKTWQAFAVLLNVKSVGVMGDNRTYDNT
FT                   VCVRVVEAVDGMTATFAHLPHTLLERISRRIINEVDGINRVVYDISSKPPATIEWE"
     gtgaaagatg tcaatattat cgttctggat ttcggttccc aatacacaca gctgattgcc        60
     cgtcgtctgc gcgaagacaa agtctattgt gaagttcttc cgtatcatac aaaaatcgat       120
     gccatcaaag ctaaaaatcc gaaagggatc attctcagcg gcggtccctc ttcggtttac       180
     aataaagatg cgtacgaagt agatcaaggg gtttatgccc tcggtattcc ggtacttggg       240
     atttgttacg ggatgcagcg catcgcggtc gatttcggcg gttcggttat ccgaagcgat       300
     catcacgaat acgggaaggc ggaactgact attgatatga cgcagcattc tgttcttttt       360
     gaagggtgtg aagatgaacg tacggtatgg atgagccatt cggataaagt cgacgtattg       420
     ccggaaggtt tcgttccgat tgcctattct ccgaattctc cgtatgcggc aatcgcaaat       480
     gaagaaaaaa tggtctatgc gatgcagtac catccggaag tcaaccactc tgaagagggg       540
     tatttgatgc ttcgcaactt tgcccgcaaa atctgtggca tcaccgaaaa atgggatatg       600
     ggccatttcc ttaaagagca aatcgtcaaa atccgcgccc aagtgggtga ggggaaagta       660
     ctatgtgccc ttagcggcgg ggtagactct tcggttgttg cggcattgtt atacgaagcg       720
     atcggcgacc agcttatccc tgttttcgtt gacaacggcc tacttcgtaa aggagaacgt       780
     gaatcggtcg aaaatatttt caaagttcac ctcaaagtgc ctctcgttgt tgccgatgca       840
     tcggaaattt tcctcggtaa acttgcgggt gtgaccgatc ctgagacgaa acgcaaaatt       900
     atcggacata cgtttatcga agtatttgaa gcggaagcga aaaaacacga cggaatcaaa       960
     ttcctcgctc aggggacatt gtaccctgac gttatcgaat cggtttcggt aaacggtcca      1020
     tccgttacga tcaaatcgca tcataatgtc ggtggattgc ccgattggat ggatttcgaa      1080
     ttgatcgaac cgcttcgtga tttattcaaa gacgaagtac gcaaactcgg tcttgaactg      1140
     ggacttccgg attcacttgt taaccgtcat ccgttcccgg ggccgggcct cgggatccgt      1200
     attatgggtg aggtcaataa accggatctt aatttgcttc gtgaagcgga tgctattttg      1260
     ctcgacgaac ttaaagcaag cggctactac accaaaacat ggcaagcatt tgcggtactt      1320
     cttaacgtaa aatcggtcgg tgttatgggt gataaccgta cctatgacaa cacggtttgt      1380
     gtccgtgtcg tcgaagcggt tgacggtatg acggctacat ttgcccatct tccgcataca      1440
     ttgcttgaac gtatcagccg ccgcatcatc aatgaagtcg acggaatcaa ccgtgtcgtc      1500
     tatgatatca gttcaaaacc gcctgcaacg atcgagtggg aataa                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page