(data stored in ACNUC7421 zone)

EMBL: CP002355.PE333

CP002355.PE333       Location/Qualifiers
FT   CDS_pept        330079..330528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0334"
FT                   /product="RDD domain containing protein"
FT                   /note="InterPro IPR010432; KEGG: tdn:Suden_0425 RDD
FT                   protein; PFAM: RDD domain containing protein; SPTR: RDD
FT                   protein; PFAM: RDD family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33001"
FT                   /db_xref="GOA:E4TZ02"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ02"
FT                   /protein_id="ADR33001.1"
FT                   /translation="MDESLDSLIQREHLQLASIRQRAAAFGIDETLLSIIMIVILWDSI
FT                   AAAHTLENMIAVTNSFLLEYMSIKIIYQTFFTMQYGASIGKIIMKIRVIEISTLSNPNF
FT                   LSAFNRSVFRIVSEILFYLGFIWAMLDPYHRSWHDRTGRTLVINA"
     atggatgaaa gcctcgattc tctaatacag cgggaacatc tgcaactcgc ttcgatacgc        60
     cagcgtgccg ctgcatttgg aatcgatgaa actcttttgt cgataattat gatcgttatt       120
     ttatgggact cgatagctgc cgcccacaca ttggaaaata tgattgcggt aacaaacagt       180
     tttttattgg aatacatgtc gatcaaaatc atttatcaga ctttttttac gatgcagtac       240
     ggtgcgagta tcggaaaaat cattatgaaa attcgtgtaa ttgaaatttc gactctttca       300
     aatccgaatt ttttgagtgc gtttaatcgg agcgtttttc gcatagtgag tgaaattctt       360
     ttttatctcg gatttatctg ggcaatgctg gacccgtatc atcgaagctg gcacgaccgc       420
     accggaagga cattggtaat caatgcataa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page