(data stored in ACNUC7421 zone)

EMBL: CP002355.PE334

CP002355.PE334       Location/Qualifiers
FT   CDS_pept        330521..332659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0335"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="COGs: COG1452 Organic solvent tolerance protein
FT                   OstA; InterPro IPR007543; KEGG: tdn:Suden_0426 organic
FT                   solvent tolerance protein, putative; PFAM: Organic solvent
FT                   tolerance protein; SPTR: Organic solvent tolerance protein,
FT                   putative; PFAM: Organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33002"
FT                   /db_xref="GOA:E4TZ03"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ03"
FT                   /protein_id="ADR33002.1"
FT                   /translation="MHKFYWISLIASTALLGNERVELFGTNMDSNGSVATAQGNPIALY
FT                   QDQIMSADKVTYDRNTSIMEAKGSVNVFKDGQHVMSEYSRINFLDETRYSVPYFAIDQS
FT                   TGLWVSTSEAQACKNLIDLSSGAISGCDSSDPLWKIRFSSADYDTDKMWVNLYNPRLEI
FT                   GDISVFYLPYFGYPTDSTRRSGLLIPTFGWSSSEGFYYQQPIYFAPQNWWDLELRPQIR
FT                   TARGSGLYTDFRFVDTPSSQGSIRMGYFKEQSRYAIENDLAHAKHYGYDVKYRHSAPLR
FT                   EWFDSTLEGESGIYIDGSWMNDVDYLNLQQSDETRNITANQVMSRINGYYSSEDNYFGA
FT                   YFKHYQYLNSASNGTTIQTLPTLQYHRYLESFLDNYLLISADAAATHYYRPNGKRAVEG
FT                   NFNIPATLQTSILDDYIDISYTANASAKVIGFYANERNGESGSTYEQGKYAQLDHTLSI
FT                   GSTLVKSYDNNITHVFNPLVSYTAAGSRYYSGYYETYRNSCNMSESYAGYPCEFYNLSA
FT                   PSDTLSLGINNYLFENGKQLLVDRLSQNFRYDDQRSYYGELQNELELEIAGAISYYNQT
FT                   AYNYDRDRITKEQNTIRYNDGVFLAGISHYYTDQLRNDTPVYASYWTADAAYQYSRNYR
FT                   FFGQVAYDYREALLKRSEVGLLYSQRCFDFGVRYVQNRRPILTNTNGSDSINDSYIFIT
FT                   VVLKPIGGSEFNYKLTDN"
     atgcataagt tttactggat aagcctgatc gcttcaacag cattgctggg aaatgagcgt        60
     gtcgaactgt ttggaacgaa tatggattcc aacggatcgg tagcgacggc gcaaggcaat       120
     ccgatagctt tatatcaaga tcagatcatg agtgccgata aagtgacata tgatcgcaat       180
     acgagcatca tggaggcgaa aggctcagtc aatgtgttca aagacggaca gcatgtgatg       240
     agtgaatact caagaataaa ctttcttgat gaaacgcgtt attcggtccc ttattttgct       300
     atagaccagt cgaccggttt gtgggtaagt acgtctgaag cgcaagcgtg taaaaattta       360
     atagatcttt ccagcggtgc gatatcggga tgcgattcca gcgatccgtt gtggaaaatt       420
     cgttttagca gcgccgatta tgataccgat aaaatgtggg taaatcttta taacccccgt       480
     ttggaaatag gagatatctc cgtattttat ctcccatatt tcggatatcc taccgattct       540
     acccgtagaa gcggattatt gattcccacc ttcggatggt caagttccga aggattttat       600
     tatcagcagc cgatatattt tgcacctcag aattggtggg atttagaact tcgtccgcag       660
     attcgtaccg ctcgggggtc aggactttat accgattttc gttttgtgga taccccctca       720
     tcccaagggt ccattcgaat ggggtatttt aaagaacagt cccggtacgc aattgaaaat       780
     gatttagctc acgcaaagca ttacgggtat gatgtaaagt atcgtcattc cgcccctttg       840
     agggaatggt ttgattcaac gctcgaagga gaatctggga tttatatcga cggttcatgg       900
     atgaatgacg tcgattactt aaatttacag caaagcgatg aaacaagaaa tatcaccgcg       960
     aatcaggtaa tgtctcgcat taacggttat tacagcagtg aagataacta tttcggagcc      1020
     tattttaaac attatcaata tttaaattcg gccagcaacg gtacgacgat tcaaacactt      1080
     ccgacccttc agtatcaccg ctatctggag agttttttag acaattatct tctaatcagc      1140
     gcagatgcgg cagcgacaca ctattatcgg ccgaacggga aaagggccgt tgagggaaat      1200
     tttaatatcc ctgcgacact tcagacatcc atattagatg attacatcga tatcagctat      1260
     acggcaaacg cctctgcaaa agtgatcgga ttttatgcca atgaacgtaa cggcgaatcg      1320
     ggaagtacgt atgaacaagg caaatatgct cagctcgatc atacattaag catcggatcg      1380
     acattggtca aatcgtatga caacaatatt actcacgtat ttaacccgtt agtgagctat      1440
     acggcagcgg ggagccgata ttacagcgga tactatgaaa cctatcgtaa ctcctgtaat      1500
     atgagcgagt catatgccgg atacccttgc gaattttata acctttctgc accgagcgat      1560
     acgctttcac tagggatcaa caattatctt tttgaaaacg gaaagcagct tcttgtggat      1620
     agactctcgc agaattttcg gtatgacgat cagcgaagct attatggtga actgcaaaat      1680
     gagttagaat tggagattgc cggagcaatt tcttactaca atcaaacggc gtataattac      1740
     gatcgcgatc gcattacgaa agaacaaaac accattcgct ataatgacgg agtttttttg      1800
     gccggcataa gccattatta tacagatcag cttcgtaacg atacacctgt ctatgcttcc      1860
     tattggacgg cagatgcagc gtatcagtat agtcgcaatt accgattctt tggacaagtt      1920
     gcatacgatt accgagaagc tctgttaaaa cggagcgagg tcggtttgct ctattctcaa      1980
     cggtgctttg attttggtgt ccgatatgtt cagaaccggc ggccgatatt aacgaatacc      2040
     aatggaagcg attccatcaa cgattcgtat atctttataa cagttgtttt aaagccgatc      2100
     ggcggatcag agtttaacta taaactcacc gataattaa                             2139
//

If you have problems or comments...

PBIL Back to PBIL home page