(data stored in ACNUC7421 zone)

EMBL: CP002355.PE335

CP002355.PE335       Location/Qualifiers
FT   CDS_pept        332674..334053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0336"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="COGs: COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents periplasmic component;
FT                   InterPro IPR003399; KEGG: nis:NIS_1335 hypothetical
FT                   protein; PFAM: Mammalian cell entry related domain protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: mce related
FT                   protein; TIGRFAM: virulence factor Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33003"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ04"
FT                   /protein_id="ADR33003.1"
FT                   /translation="MKLEAKIGLFVVMALGALLFLSTQVTSLGKWGSEGYVIQAYINDA
FT                   SGIEKHTHVLMNGVTIGDVEEITIEGKRVKLQLMIDKGVKIPVDSSVIVAQESLLGSKV
FT                   LNITVGDSASSIADGGTLSQSKQFASFDQTSDSVNAAAKELESLLRDFHAILDDEHRQA
FT                   IQEAIIAFRNVGVNLDGVIVENRDDLHAAIANFRAMGAGFTQTADTVNKDLPEIMARIN
FT                   SLTAQLDSKLPTAVDKFTNIEDNVSTILAENRSTLKTTLESAGSFFKSGEEAFGKVDSM
FT                   LSSFTTSELQVAMHTDYMMRDQYGKVYLGVNYLPNPETYYMFDLISTDDYSDANNPPKK
FT                   HQKSDTLYSLQYGKRFDNTLLRFGAIESTGGIGVDYFMNHDKLKLSAEAFDFNSVNDYR
FT                   SERAHLKAQVRYQMLKHLELYGGWDDFLNPKSQNIFLGLGLRFIDNDLKYVVGGASSMK
FT                   R"
     atgaaactgg aagctaaaat cggtcttttt gtcgttatgg cactcggtgc tttgctgttt        60
     ctttcaactc aggtcacttc actcggaaaa tggggaagcg agggatatgt cattcaagca       120
     tatattaatg atgcatccgg aattgaaaaa catacccatg ttctaatgaa cggagtcacc       180
     atcggtgatg tcgaagagat tacgatagaa ggcaaacggg tcaaattaca gctcatgatt       240
     gacaaagggg ttaaaatccc ggttgactca tcggttattg tcgcgcaaga atcgttattg       300
     ggctcaaaag tccttaatat cactgtggga gattcagcat cctcaatagc agacggaggg       360
     acactttctc aatccaagca gtttgcctca tttgatcaaa ccagtgattc ggtcaatgcg       420
     gcggcaaaag agctcgaatc tctgttacgt gatttccatg cgattttgga tgatgagcat       480
     cgtcaagcca ttcaggaagc tattatcgca ttccgtaatg tcggtgttaa tctcgatggc       540
     gtgatcgtcg aaaacagaga tgatttgcat gcggcaattg caaattttag agcaatgggt       600
     gccggattca ctcaaacggc cgatacggtt aacaaagatc ttccggaaat tatggcacgg       660
     atcaattcac tgacggcaca gctggatagc aagctcccta cggcagtaga taaatttacg       720
     aatatcgaag ataatgtcag tacaattttg gcagaaaacc gctcaacact taaaacaaca       780
     ctggagtcag ccggatcatt cttcaaaagc ggagaagagg ctttcggtaa agtggattca       840
     atgttgagca gcttcacgac aagtgaattg caagtggcaa tgcataccga ttacatgatg       900
     cgtgatcagt acggaaaagt gtacttaggt gtcaattatc tcccgaatcc cgaaacctat       960
     tatatgtttg atttaatcag taccgatgac tattcggatg ccaataatcc tccgaaaaaa      1020
     catcaaaaaa gcgataccct ctattcactt caatacggta agcggtttga taacacatta      1080
     ctccgcttcg gggcgattga atcaacaggc gggatagggg ttgattattt catgaatcac      1140
     gataagttga aactcagtgc cgaagcgttt gatttcaatt ctgtcaatga ttatagatca      1200
     gaacgggcac accttaaagc gcaagttcgg tatcaaatgt tgaaacatct tgaactttac      1260
     ggcggatggg atgatttctt gaatccgaag tcacaaaata ttttcttagg actaggcttg      1320
     cgatttattg acaacgattt gaaatacgtt gtcggcggtg cttcttcgat gaagcgataa      1380
//

If you have problems or comments...

PBIL Back to PBIL home page