(data stored in ACNUC7421 zone)

EMBL: CP002355.PE337

CP002355.PE337       Location/Qualifiers
FT   CDS_pept        336339..336716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0338"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /note="InterPro IPR005953: IPR002379: IPR000454: IPR020537;
FT                   KEGG: tdn:Suden_0429 F0F1 ATP synthase subunit C; PFAM:
FT                   H+transporting two-sector ATPase C subunit; SPTR: ATP
FT                   synthase C chain; TIGRFAM: ATP synthase F0, C subunit;
FT                   PFAM: ATP synthase subunit C; TIGRFAM: ATP synthase, F0
FT                   subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33005"
FT                   /db_xref="GOA:E4TZ06"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ06"
FT                   /protein_id="ADR33005.1"
FT                   /translation="MKKVFFLMLALVASVFGADEAVAAVETAVEAAPAVAAASADVANQ
FT                   TLKAYSMIAAGVGLGLAALGGAIGMGSTAAATIAGTARNPGLGGKLMTTMFIALAMIEA
FT                   QVIYTLVIALIALYANPYLAA"
     atgaaaaaag tattttttct tatgcttgct cttgttgctt cagtattcgg tgctgatgaa        60
     gcggtagcgg ctgttgaaac tgctgttgaa gctgcacctg ctgtagctgc tgcatctgcg       120
     gatgttgcta accaaacatt gaaagcgtat tctatgatcg ctgccggtgt tggtcttggt       180
     ttggctgcac taggtggagc aatcggtatg ggtagcactg ctgctgcaac tatcgctggt       240
     acagctcgta acccgggtct tggcggtaaa ttgatgacta ctatgttcat cgctcttgca       300
     atgatcgaag cacaagttat ctatacactt gttatcgctc ttatcgctct ttacgctaac       360
     ccatatttgg cagcgtaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page