(data stored in ACNUC7421 zone)

EMBL: CP002355.PE338

CP002355.PE338       Location/Qualifiers
FT   CDS_pept        336975..337322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1089 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33006"
FT                   /db_xref="InterPro:IPR013502"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ07"
FT                   /protein_id="ADR33006.1"
FT                   /translation="MAYITQLKHLIQNELIPDVEEHIDDIFESIASQKDATVEERAQLE
FT                   DMQALRDEYKDLLKELNSGDIDEEEAEQLYTELTSMREGEGDEDDDYFDEEDEDEDDYD
FT                   EFDLEDEDNQY"
     atggcctata ttacacaatt aaaacatttg atacaaaacg agttgattcc tgatgttgaa        60
     gaacacattg atgatatatt cgaatccatt gcatcccaaa aagatgcaac tgtcgaagag       120
     cgtgcgcagc ttgaagatat gcaggccctt cgcgatgaat acaaagattt actcaaagag       180
     cttaacagcg gcgatatcga tgaagaagag gccgagcagc tttacaccga attgacgtcc       240
     atgcgtgagg gcgaagggga tgaagatgac gactacttcg acgaagagga tgaagacgaa       300
     gacgactacg atgaattcga ccttgaagac gaagacaacc agtattaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page