(data stored in ACNUC7421 zone)

EMBL: CP002355.PE339

CP002355.PE339       Location/Qualifiers
FT   CDS_pept        337322..338065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0340"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="COGs: COG0847 DNA polymerase III epsilon subunit and
FT                   related 3'-5' exonuclease; InterPro IPR013520: IPR006055;
FT                   KEGG: tdn:Suden_1790 exonuclease; PFAM: Exonuclease RNase T
FT                   and DNA polymerase III; SMART: Exonuclease; SPTR:
FT                   Exonuclease; PFAM: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33007"
FT                   /db_xref="GOA:E4TZ08"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ08"
FT                   /protein_id="ADR33007.1"
FT                   /translation="MAKYILLDTETTGAGDDDRIIQLGYMVLDGKNVEVYNEMCSTEVA
FT                   ISYGAMEVHGITPEMIEGKPSCRETSAFQKLCELNTSDNVLIIHNAPFDLGMLTKENFS
FT                   SQMRLIDTLRCARHLFDEEESHRLQYFRYRLGLYKIEQDEAESLGIEVKAHDAIGDVLV
FT                   LKLFLTELRKRLQERYEGANPIDKMVELTKTPVFYTRALKFGKYKGKTLTEIADMDKGY
FT                   LNWMLGNMDSLDEDMRYSIERVLTS"
     atggcgaaat atattttact ggatacggaa acgacgggtg ccggggatga tgatcgaatc        60
     attcagttag ggtatatggt tctggacggc aaaaacgttg aagtctataa cgaaatgtgt       120
     tcaacggaag ttgccataag ctacggagcg atggaagttc acggtattac tccggaaatg       180
     attgaaggaa aaccttcatg ccgtgagaca tccgcttttc aaaaattatg tgaactcaat       240
     acgtctgata acgtactgat cattcataat gcaccgtttg atttgggaat gcttacgaaa       300
     gaaaactttt cgtctcaaat gcggctgatc gacacacttc ggtgtgcacg ccatctgttt       360
     gacgaagaag agtcacatcg tctgcaatat tttcgttacc gtttaggctt atataaaatc       420
     gagcaggatg aagccgagtc tttggggatt gaagttaagg cgcatgatgc gatcggtgac       480
     gtattggtgt taaaactgtt tcttaccgag ctaagaaaaa ggcttcaaga acgctatgag       540
     ggggcaaatc ctatcgacaa gatggtcgaa ttgaccaaaa cccccgtttt ttatacccgg       600
     gcattaaaat tcggaaaata taaaggcaaa acacttaccg agattgcgga tatggataaa       660
     ggatatctaa attggatgct agggaatatg gacagtctgg atgaggatat gcgctattca       720
     attgagcggg ttttaacttc ttaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page