(data stored in ACNUC7421 zone)

EMBL: CP002355.PE34

CP002355.PE34        Location/Qualifiers
FT   CDS_pept        complement(33981..35828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0034"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="COGs: COG4206 Outer membrane cobalamin receptor
FT                   protein; InterPro IPR012910: IPR000531; KEGG: sdl:Sdel_1459
FT                   TonB-dependent receptor; PFAM: TonB-dependent receptor
FT                   plug; TonB-dependent receptor; SPTR: TonB-dependent
FT                   receptor; PFAM: TonB dependent receptor; TonB-dependent
FT                   Receptor Plug Domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32702"
FT                   /db_xref="GOA:E4TW86"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW86"
FT                   /protein_id="ADR32702.1"
FT                   /translation="MYKQTISFVAAATLAASSLGADELSFHPIVVTATKTEQSLNTITS
FT                   NVEIITAEEIEEQHYTSLAEALNSLSGISITSNGGVGTTQEVFVRGMDTNKVLVLINGI
FT                   RYQDPSSTSGANFAHLLISDIEQIELIKGAQSGVWGADASAGVINIITKSAEAGTHTGA
FT                   NVEYGSFATTKWGGFLSHKTDKYDFKISFDRLMSSSFTAQAPKGDNIDRYEKDPYANTT
FT                   LNLNAHYNPTSEDTFGISYTDINALGSYDSYHSPNSVEHSDVRTRLYGVTYDKAYHNHT
FT                   LSTKANLSKFRRDELDTGYGVKVFNGQTREAELRDHFRYGENDFIVAGLSKKWDQIDFI
FT                   QADSTTGAKSVSSKAVFVTNSNTFGDLILTESLRRDDYSSFHAKTTGKMGAKYTLSEDM
FT                   YVGGNYGTSYTAPNLIQMFNPWGASNDTLSPENTKSYDLTLGYKSITLTYFENRVKDLI
FT                   EWYDPTPLNWFNNDPYYKNLNGISTFKGYEVTFRHTLLDAFVLNADYTHLARFVDKDGK
FT                   DLKRRPKREAKVSVNYYGIEDLSMGINAHYVGTRYDQADQQGEQTGRYTLFNFVLNYNL
FT                   TDSIQLYGKIDNLTDKYYQSVDGYASSPRGYYAGMKVIF"
     atgtacaaac aaaccatttc cttcgttgcc gcggcaacac tggctgcctc ttctttaggg        60
     gctgacgaac tctcattcca tccgattgtc gtaacggcga ccaaaacgga acaatctctt       120
     aacacgatca cctccaatgt tgaaattatc actgccgaag agattgaaga acaacattac       180
     acctctctag ctgaagcgct aaactcactt tccggaataa gcatcacctc gaacggtgga       240
     gtcggaacaa cacaggaagt ttttgtgcgc ggtatggata ccaataaagt attggttttg       300
     attaacggta tccgctatca ggatccctcg agtacaagcg gagccaattt cgcccacctt       360
     cttataagcg acatcgagca gatcgaactt ataaaagggg ctcaaagcgg agtatgggga       420
     gcggatgcga gcgccggagt gattaacatt atcaccaaaa gtgcggaagc gggaacccat       480
     accggtgcga atgtggaata cggaagtttt gccaccacaa agtggggggg atttctttct       540
     cataaaacgg ataaatatga ttttaaaatt tcgtttgacc gtctaatgag cagcagtttt       600
     accgcccagg cacccaaagg ggacaatatt gaccgatacg aaaaagatcc ctatgccaat       660
     acaaccctca accttaatgc ccattacaat ccgacgtccg aggatacatt cggtatcagc       720
     tataccgaca ttaacgcatt gggcagttat gacagctatc actctccaaa cagtgtagaa       780
     cacagtgatg tgagaacccg actttacggg gtaacctatg acaaagccta tcataatcat       840
     accctttcga ccaaagcgaa tctttcaaaa tttagacgtg atgagctgga taccggctac       900
     ggcgtaaaag tatttaacgg gcaaacccgt gaggctgagc tgcgcgacca ctttcgctac       960
     ggcgagaatg attttatcgt cgccggtctc tccaaaaaat gggatcaaat cgatttcatc      1020
     caagccgatt caactacggg agcaaaatcg gtttcatcga aagcggtgtt cgtgaccaac      1080
     tccaatacct tcggcgattt gattctaacg gagagtttac gacgggacga ctacagcagc      1140
     ttccatgcta aaacaaccgg taaaatgggg gcaaaatata ccctttcgga ggatatgtat      1200
     gtcggcggaa attacggaac gtcctatacg gcgcctaatc tcatccagat gtttaatccg      1260
     tggggtgcgt ctaatgatac tctcagcccc gaaaacacga aaagctacga tctcacgctc      1320
     gggtataaaa gtatcacgct cacctatttc gaaaatcggg taaaagattt gatcgagtgg      1380
     tatgatccga cccctctgaa ctggttcaat aatgacccct attacaaaaa tctaaacgga      1440
     atcagtacct ttaaagggta cgaagtcact tttcggcaca ctcttttgga tgcgttcgta      1500
     ctgaatgccg actataccca tcttgcacgc tttgtcgata aagacgggaa agatttaaaa      1560
     cgccgcccca aacgcgaagc taaagtctct gtcaactatt atgggatcga agatttgagt      1620
     atgggaataa acgcccacta tgtagggaca cgctacgatc aggcggatca gcaaggggaa      1680
     caaaccggac gttataccct ttttaatttt gtacttaact acaatctgac cgattctatc      1740
     caactctacg gtaaaattga taatcttacc gacaaatact atcaaagtgt agacggatac      1800
     gcatcgtcgc cgcgaggata ctatgcaggg atgaaggtca ttttttga                   1848
//

If you have problems or comments...

PBIL Back to PBIL home page