(data stored in ACNUC7421 zone)

EMBL: CP002355.PE340

CP002355.PE340       Location/Qualifiers
FT   CDS_pept        complement(338079..338513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lic:LIC13293 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33008"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ09"
FT                   /protein_id="ADR33008.1"
FT                   /translation="MIDALQEHRLHYQETLFNAVNPYHYRFTRYHANYSVVLAYISEES
FT                   GDLTACGDYLRGSDSIIYFRSNFCAIIFDSTNEEQGIKAANNVFSRVQARFFSKHFYMT
FT                   VITATDEKSEFQMIHDLFDLMSYALEHNMDNLVLDSSQVI"
     atgatagatg ctctgcaaga acatcggcta cattatcaag aaactttatt taatgcggtc        60
     aatccttatc actaccgatt tactcgatat catgccaatt attcggttgt tttagcctat       120
     atttcagaag aaagcgggga tttaactgcc tgcggcgact atctgagagg aagcgattca       180
     attatctatt tccgatctaa tttttgcgcc attatctttg acagtaccaa tgaagaacaa       240
     ggtattaaag cagcgaacaa tgttttctca cgggttcagg cccgtttctt ttccaaacat       300
     ttttatatga cggttatcac tgccaccgat gagaaaagcg aatttcaaat gattcatgac       360
     ctgtttgacc tgatgtccta tgcccttgaa cataatatgg ataatcttgt actcgattca       420
     tcccaagtca tctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page