(data stored in ACNUC7421 zone)

EMBL: CP002355.PE344

CP002355.PE344       Location/Qualifiers
FT   CDS_pept        341163..342239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0345"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG3864 conserved hypothetical protein; KEGG:
FT                   tdn:Suden_1781 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Predicted metallopeptidase
FT                   (DUF2201)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33012"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ13"
FT                   /protein_id="ADR33012.1"
FT                   /translation="MIDFSPLKAKLLLEYPFFGTIASGMEMVLNDNIESFAVRDNTIEY
FT                   REGYIEPLSSNERLFILCNGALHEALSHTLRRGNRSPWLWSMACDYAINALLIDNGFTP
FT                   PAKITYDKRFGNLSAEEIYAELAMEFLDQEQNDRDSDDRRDGESADEKLSRAQRERRTR
FT                   EAMEKDDPLCEAFTRQFGIHSKSRIDWRSELRDCIGGHYISDYTLVPPSKKLLYEGIYL
FT                   PGSSSRHLELAIAIDSSGSVDEVLLSCFIAEVESIMETFGSYTIDLLVCDDRIRSHTRF
FT                   ENGEHIEYVLNGGGGTDFRAVFELIESWMQRPKVLLYFTDLDGKFPLYEPPYEVLWIAP
FT                   QLADVPFGRVVVLKDENG"
     atgatcgatt tttctcctct taaagccaaa cttctcctcg aatacccgtt tttcgggacg        60
     attgcttcgg ggatggagat ggtactcaat gacaacattg aaagctttgc cgtgcgggat       120
     aacacgatcg agtaccgtga aggctatatt gagcctctga gcagtaacga gcgtttgttt       180
     attttgtgta acggcgcatt gcatgaagcg ctatcccata cgctgcggcg cggaaaccgg       240
     agtccgtggc tgtggtcaat ggcgtgcgat tatgcaatca atgcgctcct catcgacaac       300
     ggttttaccc ctccagctaa aataacctac gacaagcggt ttggaaatct cagtgccgaa       360
     gagatttatg ctgagcttgc aatggagttt ttggatcagg aacaaaatga ccgggactcg       420
     gatgatcggc gcgacggcga gagtgccgat gaaaaactct cgcgtgccca gcgtgaacgt       480
     cgtacacgcg aagcgatgga aaaagacgat cccctctgtg aagcatttac gcgtcaattc       540
     gggatacatt caaaaagtcg gatcgactgg agaagcgaat tacgcgattg tatcggcggg       600
     cattacatca gcgattacac ccttgttccg ccatcaaaaa agcttcttta tgaggggata       660
     tatctgccgg gatcgtcgtc ccgtcatttg gaactcgcca ttgcgatcga cagctcggga       720
     tcggtggatg aggtactgct ctcatgcttt atcgccgagg tagagtcgat tatggagacg       780
     ttcggctcgt acactatcga tcttctggtg tgtgatgatc ggatccgaag ccatacacgg       840
     tttgaaaacg gtgaacatat cgagtatgtt ttgaacggag gaggggggac cgattttagg       900
     gcggtattcg aactcataga gtcgtggatg cagcgtccga aagttctttt gtattttacc       960
     gatctggatg gtaaatttcc cctctatgaa ccgccgtacg aggttctttg gatagcaccc      1020
     caactggcag atgtgccgtt tggacgagtg gtcgtactaa aggatgaaaa tggttga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page