(data stored in ACNUC7421 zone)

EMBL: CP002355.PE346

CP002355.PE346       Location/Qualifiers
FT   CDS_pept        complement(343727..344473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0347"
FT                   /product="Conserved hypothetical protein CHP00245"
FT                   /note="COGs: COG0390 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR005226; KEGG:
FT                   pmx:PERMA_1353 hypothetical protein; PFAM: Conserved
FT                   hypothetical protein CHP00245; SPTR: Putative membrane
FT                   protein; PFAM: Uncharacterised protein family (UPF0014);
FT                   TIGRFAM: conserved hypothetical protein TIGR00245"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33014"
FT                   /db_xref="GOA:E4TZ15"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ15"
FT                   /protein_id="ADR33014.1"
FT                   /translation="MQYSFLASYLLIVFALWYSRREQFGLEKMILTNSILAMVQLGLLG
FT                   YALVYLFQMQHPALLFFVLLGMVTFGAYTAKKRAPLGEHSFKIALFSLGASSGIVFLSM
FT                   MAFGVIHIVPHEMIPIGGMIIGNALNVYSQSIERFRAEVKNTIETIEGMVALGAPLKEA
FT                   LSFASKASVKASMIPTLNMLQTVGIIHIPGITTGMLLAGADPLKAISYQLAVMYMMVAV
FT                   ALLSAVFSVMFSYRLIVGAAFDKSKS"
     atgcaatact cttttttagc ctcctacctt ctcatcgtct ttgccctttg gtactcacgt        60
     cgcgaacagt tcggtctgga aaaaatgatc cttaccaatt cgatcctcgc catggtgcaa       120
     ttaggacttc tcggctatgc cctcgtctat ctttttcaga tgcaacaccc cgctctgctc       180
     ttttttgtcc ttttggggat ggtgacgttc ggagcctata ccgccaaaaa gcgtgcacct       240
     ctgggcgaac acagtttcaa aattgctctc tttagcctcg gggcctcttc agggatcgtc       300
     tttttatcaa tgatggcgtt cggcgttatt catatagtgc ctcatgagat gatcccgatc       360
     ggggggatga ttatcggcaa tgcattgaat gtctattctc agagtatcga gcggtttcgt       420
     gccgaggtaa aaaatacgat tgagacgatc gaggggatgg tcgcactggg tgcacctcta       480
     aaagaggctc tatcatttgc ttcaaaagcc tccgttaaag cctcgatgat cccgacactc       540
     aatatgctcc aaacggtcgg gatcatccat attcccggga ttacgacggg gatgctcctc       600
     gccggcgccg atccgctcaa agcgatctcc tatcagctcg ccgtcatgta catgatggtc       660
     gctgtggcgc tactatcagc ggtatttagc gtgatgttct cctatcgcct gattgtaggt       720
     gcagcgtttg ataaaagcaa aagttaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page