(data stored in ACNUC7421 zone)

EMBL: CP002355.PE347

CP002355.PE347       Location/Qualifiers
FT   CDS_pept        complement(344650..345246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0348"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="COGs: COG0450 Peroxiredoxin; InterPro IPR000866:
FT                   IPR019479: IPR017936; KEGG: sdl:Sdel_0223 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; Peroxiredoxin-like;
FT                   SPTR: Alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; PFAM: C-terminal domain of 1-Cys
FT                   peroxiredoxin; AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33015"
FT                   /db_xref="GOA:E4TZ16"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ16"
FT                   /protein_id="ADR33015.1"
FT                   /translation="MLVTKKAPDFTATTVLGNNQIVDNFNLYENLGEKGAVLFFYPLDF
FT                   TFVCPSEIIAFDHRLEEFTARGINVIGVSVDSQFSHFAWKNTPVKEGGIGQVRYPLVAD
FT                   LNKQISRDYDVLLGDSVALRGSFLLDKDGTIRHAVINDLPLGRNIDEMLRMIDAMLFTN
FT                   EHGEVCPAGWAKGDAGMKASTEGVAEYLSAHAETL"
     atgctcgtaa ccaaaaaagc cccggatttt accgctacaa ccgttcttgg aaacaaccag        60
     atcgttgata atttcaatct ttatgaaaac ctcggtgaaa aaggtgccgt cttgtttttc       120
     tatccgttgg attttacatt cgtttgtccg tctgagatta tcgcattcga tcaccgtttg       180
     gaagaattta ctgcgcgcgg tatcaatgtt atcggtgtat cggttgactc acaattcagc       240
     cacttcgcat ggaaaaacac tccggtaaaa gagggtggta tcggtcaagt tcgctacccg       300
     ctcgtagcag atttgaacaa acaaatctca cgcgattatg atgtattgct cggtgattct       360
     gtagcacttc gcggttcgtt cttgcttgat aaagacggaa caatccgtca cgcggtaatc       420
     aacgaccttc cgcttggacg caacatcgat gaaatgcttc gtatgatcga tgcgatgttg       480
     ttcacgaatg agcatggtga agtttgtcct gcaggttggg caaaaggtga cgccggtatg       540
     aaagcaagca cagaaggtgt tgctgaatat ctttctgcac acgcagagac actttaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page