(data stored in ACNUC7421 zone)

EMBL: CP002355.PE348

CP002355.PE348       Location/Qualifiers
FT   CDS_pept        345409..347175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0349"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components; InterProIPR001140:
FT                   IPR003439: IPR017871: IPR003593: IPR 017940; KEGG:
FT                   abu:Abu_1106 ABC transporter, ATP-binding protein; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase; SPTR: ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter transmembrane
FT                   region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33016"
FT                   /db_xref="GOA:E4TZ17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ17"
FT                   /protein_id="ADR33016.1"
FT                   /translation="MITFKTLFGMMLRYKRSLFWGNVIAIIATLVSIPIPLLIPLMVDE
FT                   VLLEKGGTVTGVIDQLSSAHDPLIYIGIVLAVTITLRFLFFILSVVSQKFFITLSQELS
FT                   FTIRVRALEHLKHVSMSSYERLGSGKVITHLITDIDTIEQFLGSALSKLIVSVATLIGV
FT                   AVVLIWINPLFGILILIFQPLIMLVTRKISGRVGMLKKEQNRTIGELSDTLTQMCDLFG
FT                   QIRASNKEERFIDNAIDHSKRLRQSASEYGIKALMGERYSYTLFLSGFEIFRALGLVMV
FT                   LYSHLSIGLMFGIFGYLWFMMTPVQDLLSLQYSFANAKNALQRLNELLSLPTEPTANVS
FT                   AQSISASGPLSIHTENLVFGYDEKEPVLRGVNLDIHAGSTVAIIGASGSGKSTLSQLLV
FT                   GFYPPTSGDIFYNGVSVRDIGFPNVRDAVFVVLQQPLMFNDTLRFNLTMGDEIRDDEIQ
FT                   KALEIAQLSEFVSTLPDGLNTQVGKFGIRLSGGQRQRLSIARMVLAKPKAVIFDESTSA
FT                   LDVHTESKLFEALEAFLKDKTVIIIAHRLSTVTRADYIYVLENGIILEEGTRDVLEAID
FT                   GSYKRFINSQHG"
     atgattacat ttaaaaccct atttggcatg atgctacgct ataaacgctc tttattttgg        60
     ggaaatgtta ttgcgatcat agcaacattg gtctccatac cgattccgtt actgatcccg       120
     ctaatggtag atgaggttct tttagaaaaa gggggaacgg ttaccggtgt aatcgatcag       180
     ttaagctcgg cacatgatcc tctgatctat atcgggatcg ttctggcggt gacgatcact       240
     cttcgatttt tattttttat tttgagtgtt gtctctcaaa agttttttat cactctttcc       300
     caagaactca gttttaccat ccgcgtccgt gcactggaac atctaaaaca tgtttcgatg       360
     agttcatacg agcgtctggg aagcggtaaa gtcattaccc atctcatcac cgatatcgat       420
     acgattgagc agtttttggg gagtgccctt tcaaaactca tcgtctctgt cgcaaccttg       480
     atcggtgttg cggtcgtttt gatctggata aatccccttt tcggaatcct cattctcatt       540
     tttcagccgc tcattatgct ggtgacccgt aaaatatcgg gcagagtggg gatgctaaaa       600
     aaagagcaga accgtactat aggggagctt tccgatacgc tgacccagat gtgtgatctt       660
     tttgggcaga tccgggcaag caacaaggaa gagcgtttta tcgacaacgc aatcgatcac       720
     tccaaacggc tgagacaaag tgccagtgaa tacggtataa aagcgctgat gggtgagcgg       780
     tattcatata ccctgtttct cagcggattc gaaatcttcc gtgcgcttgg tcttgtgatg       840
     gttctatatt cgcatctctc tatcggtctg atgttcggga ttttcggcta tttgtggttt       900
     atgatgaccc ctgtgcagga tttactttcg ctgcaataca gctttgccaa tgccaaaaat       960
     gcccttcagc gattgaatga gttgttgtct cttccgaccg aaccgacggc taatgtctct      1020
     gcacaatcca tatcggcgtc tgggcccctt tcgatccata cagaaaatct ggtatttgga      1080
     tacgatgaga aagagccggt attgcggggg gtgaatctcg atatacatgc cggaagtacc      1140
     gttgcgatta ttggagcaag cggaagcgga aaaagtacct tgtcgcaact gttagttgga      1200
     ttttatccac ctacctcagg cgatatcttt tataatggtg tcagtgtacg tgatatcggt      1260
     tttccgaatg tacgcgacgc cgtttttgtc gtgctgcagc agccgctgat gtttaacgat      1320
     acccttcgat tcaacttgac gatgggggat gagatcagag atgatgagat tcaaaaagca      1380
     ttggagatag cacagctttc ggagtttgtg tcgacgttgc cggatgggtt aaacactcag      1440
     gtcggaaaat tcggcatccg attgtccggc ggacaacgcc agcgtctctc tattgcacgg      1500
     atggtattgg ccaagcccaa agcggtcatt tttgacgaat ccacttcagc cctcgacgtg      1560
     catacggaga gcaaactttt tgaagcattg gaagcatttt tgaaagataa aacggtgata      1620
     atcattgccc atcggctgag tacggtgaca cgcgccgatt acatctatgt gttggaaaac      1680
     ggtattattc tcgaagaggg gactcgtgat gttttggaag ccatcgacgg cagttacaag      1740
     cgatttataa attctcagca cggataa                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page