(data stored in ACNUC7421 zone)

EMBL: CP002355.PE349

CP002355.PE349       Location/Qualifiers
FT   CDS_pept        347185..348252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0350"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="COGs: COG0628 permease; InterPro IPR002549:
FT                   IPR020606; KEGG: sdl:Sdel_1219 protein of unknown function
FT                   UPF0118; PFAM: protein of unknown function UPF0118; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33017"
FT                   /db_xref="GOA:E4TZ18"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ18"
FT                   /protein_id="ADR33017.1"
FT                   /translation="MQQNNFLRWMSFGIFVLILWLFSPFLKSFFVALLLAMAVSPLYRS
FT                   IKSRIDRYPALVSVASLVSASIVSIGLSLIIFLPIAIFLYQILDNPAKTLDMIRMIGNK
FT                   IDSPYLNLPTFLQWLSDPLYNLLTQIRNHKDEIIAFLAGWFGSGIKTFASMLGEMAMIV
FT                   IFFFFLTWYGRRLLLFLLPIIPLPRSIKRDFLDEMTIMSAVVFYTLVGVMIAQGLAFGI
FT                   FIAFFEGYNPLLLGFLTGISAIIPVVGTALVWIPVAVHEYMSGNIVNAFIISLYSWAMM
FT                   AFFIDNIVKLVILNFVNRSLSIGKRRINEFVIFFAIVGGLATFGFWGFILGPAIVAFAM
FT                   TTLRTLRKTNRVLLP"
     atgcagcaaa ataatttttt acgttggatg agttttggta tatttgttct cattctatgg        60
     cttttttccc cattcttgaa gagctttttt gtagcactct tattggctat ggcggtttca       120
     ccgctgtaca gatcgattaa atcccgtata gatcgctatc ctgcactcgt ttccgtcgct       180
     tcacttgttt ccgcgtcgat tgtcagtatc ggtctttcat tgataatctt tttaccgata       240
     gccatttttt tgtatcagat acttgataat cctgccaaaa ctcttgatat gatccgtatg       300
     atcgggaata agattgattc cccttatttg aatcttccca catttttgca atggcttagc       360
     gatccccttt ataacctctt gacacagatc cgaaaccaca aggatgaaat catcgctttt       420
     ctcgcgggat ggttcggaag cggaatcaaa acatttgcct ccatgttggg tgagatggcg       480
     atgatcgtca tttttttctt ctttctgaca tggtacggcc ggcgcctttt attgtttctg       540
     ctccccatta ttccgttgcc gcgttcgatt aagagggatt ttttggatga gatgacgatc       600
     atgagtgccg ttgtgtttta tactttggtc ggtgttatga tcgcacaagg gcttgcattc       660
     ggaatattta tcgcattttt tgaggggtat aaccctttgc ttctgggttt tttaaccggg       720
     atttcggcga ttattcccgt cgtcggaacc gcgttggttt ggattccggt tgcggtacat       780
     gaatatatgt cgggaaacat cgtaaacgca tttataattt ctctctattc ctgggccatg       840
     atggcttttt tcatcgataa tattgtcaaa ttggtaattt tgaattttgt aaaccgctct       900
     ttgagtatcg gaaaacggag aataaacgag tttgtgatct tttttgcgat tgtaggtgga       960
     ttggcgacat tcggattctg gggatttatt ttgggaccgg cgatcgttgc ttttgcgatg      1020
     acaacgctta ggacattgcg taaaacaaac cgtgttcttc tcccctga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page