(data stored in ACNUC7421 zone)

EMBL: CP002355.PE350

CP002355.PE350       Location/Qualifiers
FT   CDS_pept        complement(348272..348580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_1614 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33018"
FT                   /db_xref="GOA:E4TZ19"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ19"
FT                   /protein_id="ADR33018.1"
FT                   /translation="MNQDNTLSFIVGAALGGIAGYFLFKHQDQIVDKIHELEGNLNIDH
FT                   NALIDKAKHKLDALTQNVQSTIERYTHGSEDKSTDEITSIMAELAKLREEVRELKAI"
     atgaaccaag acaatacact cagttttatc gtaggtgccg cactcggcgg aattgcggga        60
     tattttcttt ttaaacatca agaccagatt gtggataaga tccatgaact tgaggggaat       120
     ctcaatatcg accataacgc tttgatcgat aaagcaaaac acaaactcga tgccctaacc       180
     caaaacgtac aatcaacgat tgaacgctat acgcacggca gtgaagacaa atcaaccgat       240
     gaaatcacat cgatcatggc ggaactagcc aagcttcgcg aagaagtcag agagctcaaa       300
     gcaatctaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page