(data stored in ACNUC7421 zone)

EMBL: CP002355.PE352

CP002355.PE352       Location/Qualifiers
FT   CDS_pept        349133..349777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0353"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1192 ATPase involved in chromosome
FT                   partitioning; KEGG: seh:SeHA_A0032 ParA protein homolog;
FT                   SPTR: Partitioning protein, putative; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33020"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ21"
FT                   /protein_id="ADR33020.1"
FT                   /translation="MILTLSHQKGGVGKSTVAWNLAVYFSGIMDTRIVDLDTQRSLTVT
FT                   NALRKEHNLPSIKMIHFNTAEELAEYAAADSDDVLTIIDSGGFDSAFNRIAIIASDLLI
FT                   TPVSDKPFDLMGLQKYEEILKSLSVIQGETIKTHVLFNNINPAMKRFGELVDFICTSEH
FT                   FELMVSILRQRVDIAHSVGEGKSIKEYRIFSKADQEMDDLIVEVKSILNIK"
     atgatcctga ctctttccca ccaaaaaggg ggtgtcggca aatctacggt agcatggaat        60
     cttgccgttt atttctccgg catcatggat acccgtatcg tagatcttga tacccaacgt       120
     tctcttaccg tgacgaacgc acttcgtaaa gaacataatc taccctcgat aaaaatgatc       180
     cattttaata ctgccgaaga gttggcggag tatgcggcgg cagattcgga tgacgttctg       240
     accattatcg attcgggggg atttgacagt gcttttaacc gtatcgcaat tatcgcttcg       300
     gatctgctta ttaccccggt gagtgataag ccgtttgatc tgatggggct gcaaaagtac       360
     gaagagatac tcaaaagtct ctcagtaatc caaggcgaaa cgattaaaac ccatgtcctt       420
     tttaacaata tcaatcccgc aatgaaacgg ttcggcgagt tggttgattt tatctgtaca       480
     tccgaacatt tcgaactgat ggtttccatc ctccgccagc gcgttgatat cgcccattcc       540
     gtaggtgaag gaaaaagtat caaagaatac cggattttca gtaaagccga tcaggaaatg       600
     gatgatctga ttgtggaagt taaatctatt ttgaatataa aatag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page