(data stored in ACNUC7421 zone)

EMBL: CP002355.PE353

CP002355.PE353       Location/Qualifiers
FT   CDS_pept        349818..350039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cro:ROD_p1521 hypothetical protein; SPTR:
FT                   Merozoite surface protein 3b"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33021"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ22"
FT                   /protein_id="ADR33021.1"
FT                   /translation="MAKKSFLQNIEKVKSSAAMSEREESAKSDKEKKKKLITIPTQWEE
FT                   KIREYHGGTVSAYILIALQERMQRDGLI"
     gtggcaaaaa agagttttct gcaaaatatt gaaaaagtaa aaagttcggc agctatgagc        60
     gaaagagagg agagtgcaaa gagtgacaaa gagaagaaaa agaaattgat aaccatcccg       120
     acgcagtggg aagaaaaaat ccgggaatat cacggcggga cggtgagtgc gtatattcta       180
     atagcgcttc aggaacggat gcagcgtgac ggattgatat ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page