(data stored in ACNUC7421 zone)

EMBL: CP002355.PE354

CP002355.PE354       Location/Qualifiers
FT   CDS_pept        350483..351859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0355"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterProIPR000014:
FT                   IPR000160: IPR013655: IPR001610: IPR 000700; KEGG:
FT                   abu:Abu_0739 GGDEF/PAS domain-containing protein; PFAM:
FT                   GGDEF domain containing protein; PAS fold-3 domain protein;
FT                   SMART: GGDEF domain containing protein; PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   SPTR: GGDEF/PAS domain protein; TIGRFAM: diguanylate
FT                   cyclase; PAS sensor protein; PFAM: GGDEF domain; PAS fold;
FT                   TIGRFAM: PAS domain S-box; diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33022"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ23"
FT                   /protein_id="ADR33022.1"
FT                   /translation="MIKIINSEEFSYFLRVHRNKIIKIWMEKSEVQNVLHRHSLPIIDK
FT                   NTYLFYQFCDCFISVIEWRSTISECQIKIDFLQLLNNYNVTVADLFTLVFKLKNAIEQV
FT                   IFENGNLSYALQSEIDSLTLQMAIDLELNFETIINSNQNYKSENSNLLTEYKKAVDLSN
FT                   IVSKTNPKGIITYVNDKFCEISGYSRDELIGKPHNIIRHPDMPREAFKELWDTIKAKKS
FT                   WSGVVTNMKKDGGQYIVDTTVIPILDVDGDVVEYIAIRHDITELEQTKQQLRNINKAMK
FT                   NKVDELYSMTNTLEQKAYKDKLTGINNRENFEDIFALEIATAKQNNIPLSLVIFDVDNF
FT                   KLVNDTYGHQAGDTILIDLVKLIEDNIKNGDIFARWGGEEFVILTPSTDINGACNLAEN
FT                   LRKLVQLHPFSYVENQMTLSFGVAQLSDDDNKKTLFEKADGALYEAKKNGRNRVEGCKV
FT                   "
     atgataaaaa taataaatag tgaagagttt tcttattttt tacgtgtcca cagaaataaa        60
     ataataaaga tttggatgga aaaaagtgaa gtacagaatg tacttcatag gcattcttta       120
     ccgattatag acaaaaacac ctatcttttt tatcagtttt gcgattgttt catcagcgtg       180
     atcgaatggc ggtcaactat ttcggaatgt cagatcaaaa tagatttttt acagctattg       240
     aacaactaca acgtaacggt ggccgatctg ttcacattgg tattcaaact gaaaaatgcg       300
     attgagcagg ttattttcga aaacggaaac ctctcgtatg cgttgcagag tgagattgat       360
     tcgctgaccc ttcagatggc gattgattta gaattgaatt ttgaaaccat tataaacagc       420
     aaccaaaatt acaaaagtga aaattccaat cttttaaccg agtataaaaa agcggttgat       480
     ctgagtaata ttgtttcgaa aacaaacccc aaagggatta ttacgtatgt gaatgacaag       540
     ttttgcgaaa tatcgggcta ctcaagagat gagcttatcg gcaaaccgca taatatcatt       600
     agacatccgg atatgccaag agaagcattt aaagagctgt gggacactat caaagcgaaa       660
     aaaagctgga gcggcgttgt caccaatatg aaaaaagacg gcggtcagta tattgtcgat       720
     acaacagtca taccgatatt ggatgtggac ggggatgttg ttgaatacat cgcgatccgt       780
     catgatatta ccgagcttga acaaaccaaa caacagttga gaaacatcaa caaagcgatg       840
     aaaaacaaag tcgatgaact ttattcgatg accaatacgt tagaacaaaa agcgtacaaa       900
     gataagttga ccgggataaa taatcgtgaa aactttgaag acatattcgc attggagatc       960
     gctacagcga agcaaaacaa tatcccgctt tcattagtaa tcttcgatgt tgacaacttt      1020
     aaactggtaa acgataccta tgggcatcag gcgggtgaca ctattttgat cgatttggtg      1080
     aagctgattg aagataacat taagaacgga gatatttttg cacgatgggg aggagaagaa      1140
     ttcgtcatat taactccctc tacagacatt aacggcgctt gtaatttggc tgaaaatcta      1200
     agaaaacttg tccagctgca cccgtttagc tatgtcgaaa atcagatgac gctcagtttc      1260
     ggggttgcgc agctttccga cgatgacaac aaaaaaacac tgttcgaaaa agcggacgga      1320
     gcattgtatg aagcaaagaa aaacggcaga aacagggtgg aagggtgtaa ggtttga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page