(data stored in ACNUC7421 zone)

EMBL: CP002355.PE355

CP002355.PE355       Location/Qualifiers
FT   CDS_pept        complement(351862..352392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_0519 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33023"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ24"
FT                   /protein_id="ADR33023.1"
FT                   /translation="MNKIVLILLIPLLLYGTTYDATLLQIGAKIFPKVALMEKGTKERI
FT                   QSTVNFVIVASPSNKAAAQRLSEIIEHQYNGILADHPLALFVVSPKEALEIKNAHSFVL
FT                   LMDPDDSILPMVLEHAAKTKTLTFSFDPLLLQKGAAVSLYIGRSVKPYINLATLKQVPF
FT                   TFEYGFLKLSQPY"
     atgaacaaaa tagttcttat tcttctcatc cctttactcc tttacggcac aacgtacgat        60
     gcgacgctat tgcagattgg ggcaaaaata tttcctaaag tcgccttaat ggaaaaaggg       120
     acaaaagaac gtattcaatc gaccgtaaac tttgttattg tcgcgtcccc gtccaacaaa       180
     gcggctgcgc agcgattatc ggagataata gagcatcagt acaatggtat cctagccgat       240
     catccactgg ccctctttgt tgtctcaccc aaagaagcat tggagatcaa aaatgcacac       300
     agctttgttt tgctcatgga cccggatgac agtattctgc ctatggtgtt agaacatgcc       360
     gcaaaaacaa aaactctgac gtttagtttc gatcctttac tgctgcaaaa aggggctgcc       420
     gtttcgcttt acatcggtag aagcgtcaag ccttatatca accttgccac gcttaaacag       480
     gtccccttta cgtttgaata cggtttctta aaactttctc agccctatta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page