(data stored in ACNUC7421 zone)

EMBL: CP002355.PE356

CP002355.PE356       Location/Qualifiers
FT   CDS_pept        complement(352389..353819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0357"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system; InterPro
FT                   IPR003594: IPR004358: IPR005467; KEGG: abu:Abu_0455
FT                   two-component sensor histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; SPTR: PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33024"
FT                   /db_xref="GOA:E4TZ25"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ25"
FT                   /protein_id="ADR33024.1"
FT                   /translation="MTQTLIGKFAWVFWLLYIAVIAPIYIFVQVNVSSVLNESEKAKIE
FT                   LIIQTLKPIISTYLTFDQTDMLNDTMRTFFQNPNIKDVSLVDVNQNIIFERHYPHSNIH
FT                   KTITLTTPVIDSITHQTQATLIISYSNNFVHDLQYKLFTQLIVLSLFALLIFTITYIYF
FT                   RKQFFVLRLLANWMGDYSIHKASEPFKSDNNNTEILTITSSANKMVETIEDYRVQMEEI
FT                   NNELEMRVENEIIQRREKEQLLIHQSRLAAMGEMIESIAHQWRQPLNIIGLAVADMNMK
FT                   RALGSLGEQELEKNTAIIDNNLQFMSNTIDDFRNFFNMDKESLNFSPVQPIHEIFSLLD
FT                   EQLRYANITYLIHENCNQEIFGVVNEFKQVILNIINNAQDAIKSRKNQIGGKIEITLRC
FT                   DINYLYIDISDTGGGVPIKIVERIFEPYFTTKLHNKGTGIGLYMSKVIIEQHFEGSLSV
FT                   SNTDDGALFTITMPLKHT"
     atgacacaaa cgcttatcgg gaaattcgca tgggtattct ggctgcttta tatcgcagtt        60
     atagccccaa tatatatctt tgttcaagtt aatgtctctt cagtcctcaa cgaaagcgaa       120
     aaagcaaaaa ttgagctgat tatccaaacg ctcaaaccga tcatctctac ctatctgaca       180
     ttcgatcaaa cagatatgct caacgatacg atgcgtacat tttttcaaaa tcctaatatt       240
     aaagatgtat cgttggtcga tgtcaaccaa aatattattt ttgaacgcca ttatccgcat       300
     tccaatatcc ataaaaccat aaccctcacg acacctgtaa tcgattctat cacccatcag       360
     acacaggcga ctctgataat cagttattca aataatttcg ttcacgatct acagtacaaa       420
     ctttttacgc aattgattgt cctctcgctg tttgcgcttc tgatatttac aattacctat       480
     atctatttca gaaagcagtt ttttgtcctt cgtctcttgg caaactggat gggagactat       540
     tcgattcaca aagcttccga gccgtttaaa agcgataaca acaatactga aattctgacc       600
     attacctctt cagccaacaa aatggtcgag accattgaag actaccgcgt ccaaatggaa       660
     gagatcaaca acgaactcga aatgcgcgtc gaaaatgaaa ttattcagcg tcgtgaaaaa       720
     gagcagcttc ttatccacca gtcacgcctc gccgcaatgg gtgaaatgat tgaaagtatc       780
     gcccatcagt ggcgtcagcc tttgaatatc atcggtcttg cggttgccga tatgaacatg       840
     aaacgcgcac tcggttctct tggtgaacag gagcttgaaa aaaataccgc tatcatcgat       900
     aataatctcc agttcatgtc caatacgatc gatgattttc gaaacttttt caatatggac       960
     aaagagtctc tcaatttctc accggtccag cctatccatg aaattttctc ccttttggat      1020
     gagcagctcc gctacgcaaa tatcacctat ctcatacatg aaaactgtaa tcaagaaatt      1080
     ttcggcgttg tcaacgaatt caaacaggtt attttgaata ttatcaataa tgctcaagac      1140
     gctattaaaa gccggaaaaa tcaaatcgga ggaaagatcg aaataacatt gcgctgcgac      1200
     ataaactatc tttatatcga tatcagcgat acgggaggcg gtgttccgat taaaatcgtt      1260
     gaacgtattt tcgaacctta ttttacaacc aaacttcata ataaggggac aggaatcggg      1320
     ctttacatgt ccaaagtcat tattgaacaa cacttcgaag ggagcctcag cgtgagtaac      1380
     accgatgatg gagccctttt caccattact atgcctttga aacacacatg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page