(data stored in ACNUC7421 zone)

EMBL: CP002355.PE357

CP002355.PE357       Location/Qualifiers
FT   CDS_pept        complement(353962..356094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0358"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG4206 Outer membrane cobalamin receptor
FT                   protein; InterPro IPR012910: IPR000531: IPR006162; KEGG:
FT                   alv:Alvin_0601 TonB-dependent receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   SPTR: TonB-dependent receptor; PFAM: TonB-dependent
FT                   Receptor Plug Domain; TonB dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33025"
FT                   /db_xref="GOA:E4TZ26"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ26"
FT                   /protein_id="ADR33025.1"
FT                   /translation="MNITLILILFQYGAKLKHLSVFCISLLFSHSLLLAESSDDLDKVL
FT                   EEATTIATKTKLNADYVPGTVTVISSEKLKSLGITNLAEQNAFDMIVGFDSSTLSLRGS
FT                   GSIYGAEGNKIKWMINDKPISAEIWGIPKLGVGQIVFPIPTDAIDRIEIIRGPGSAIYG
FT                   GNAIYGVVNIITKKETGTLFTTLSQMQSNKFGKALGGYTSFRQNDLEASAIISAEKSDG
FT                   WDLPITTQAPAGSGNLPNAYGNSLIMADVSYKNFDFWAYKLKAKNDYARLQWDPSNFLP
FT                   QDNTEPVQSNTYTMLGVQGKFEITSNLLLTAKAGINQYENNADVMFFPSYLLGSNPSNL
FT                   DGVRKIDYRESTKYLEGMVETTIGSNRLLGGAYAGFLSVDQDDVTQMWSRVSGRTVYNP
FT                   SGTSTHLLTTNNPKRINRALYLQDEIQLDEQSTVTVGARYDTYSDGREALSPRIALVYQ
FT                   YDESNILKAQYSRAFRPPSFSEQYSPNNQASHTDYESETTDTIELSYIFKTKGSSLKTT
FT                   VFNTRTANMITYHDFTYETINLESPTTVNGLEIELSQNYESLALGANLSFYKSRRGDVE
FT                   LTRAGSTLNYDSSEFALSAKFIGNLFATLNSDTPYPTTVWYHYTGNKHRVNNETLDENG
FT                   NVKGIYTTNGSTPVQDYVNITQKINGIAKDLDLEFGVKNLFGKTLKTLYFPLNPPNTSD
FT                   IPYMKQTFWVNLLYRF"
     atgaatatta cactcatatt gatacttttt cagtacggag ccaaattgaa gcatttatca        60
     gtcttttgca tctcgctgtt attctcacat tcactgctct tagccgaaag cagcgatgac       120
     cttgataaag tactggaaga agcaaccacc attgcgacaa agaccaagtt aaatgccgat       180
     tacgtccccg gtaccgtaac ggtcatcagc agtgaaaaat taaaatcgct ggggataacc       240
     aatcttgccg agcagaatgc gtttgacatg attgtaggat ttgactcctc caccctctcg       300
     ctcagaggct caggctcaat atacggggca gaagggaaca aaataaaatg gatgatcaat       360
     gacaaaccga taagtgcgga gatatgggga attccgaagc tgggtgtcgg gcagatagtt       420
     tttccgatac cgaccgatgc gatcgaccgg atcgaaatca tcagagggcc cggttcagcc       480
     atatatggcg gaaacgctat ttacggcgta gtcaatatca ttactaaaaa agagacgggt       540
     actttattta cgaccctgtc tcagatgcaa agcaataaat tcggtaaagc gttgggaggc       600
     tatacctctt ttagacaaaa cgacctggaa gcatccgcga ttatctcagc cgaaaaaagc       660
     gatggctggg atttgccgat aacgacccaa gctccggccg gaagcggcaa tcttccgaat       720
     gcatacggaa acagcctgat tatggcggat gtctcctata aaaattttga tttctgggca       780
     tacaaattaa aagccaaaaa cgactatgcc cgtctgcaat gggacccgtc caactttttg       840
     ccgcaagaca acaccgaacc tgtccaatcc aatacgtaca ccatgctggg tgtgcaagga       900
     aagtttgaaa ttacttccaa tctgttatta acggcaaaag ccgggatcaa tcaatacgaa       960
     aacaatgctg acgtcatgtt ttttccctca tacctgctgg gaagcaatcc gagcaatctg      1020
     gacggtgtgc gtaaaatcga ttacagagaa agtacaaaat atctcgaagg aatggtagaa      1080
     acaacgatag gttccaatcg attgcttggc ggagcctatg ccggatttct gtcggttgat      1140
     caagacgatg ttacccaaat gtggagccgt gtcagcgggc gcactgtcta taatccatca      1200
     ggtacatcga cccatttgct aacaacaaac aatcccaaaa gaatcaacag agccctctat      1260
     ctgcaagatg aaatacagct cgatgaacaa agcacggtca ccgtcggagc acgctatgac      1320
     acctacagtg acggacggga agctttatct ccaagaatcg cactggtata tcaatacgat      1380
     gaatctaata ttctaaaagc tcaatattca agagcgttta gaccgcctag cttttcagag      1440
     cagtattctc ccaataatca ggcttcacat acagactatg agtcagaaac aaccgataca      1500
     atcgagttgt catacatttt taaaaccaaa ggttcttccc tcaaaacaac cgtattcaac      1560
     accagaacag ctaacatgat tacgtatcat gatttcacct atgaaacgat caatctcgaa      1620
     agtcctacga cggtaaacgg tctggaaatc gagttgagcc aaaattatga atcgctcgct      1680
     ttaggtgcga acctgtcatt ttacaaatcg cgcaggggag atgtcgaatt aactagagcc      1740
     ggatctactc tcaattatga ttccagcgaa tttgcactct cggctaaatt tatagggaac      1800
     ctgtttgcta cccttaacag cgatacgccg tatccgacca ctgtatggta tcactatacg      1860
     ggaaacaaac accgtgtaaa caacgagacg ctggatgaaa acggcaatgt aaaagggata      1920
     tataccacga acggctccac acccgtacaa gattatgtca atattaccca aaaaatcaac      1980
     ggaatcgcaa aagacctcga tttggaattc ggggtaaaaa atctcttcgg caaaacacta      2040
     aaaactctct atttcccgtt aaatccgccg aatacgagtg acattccgta tatgaagcag      2100
     acattttggg tcaatttact gtatagattt taa                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page