(data stored in ACNUC7421 zone)

EMBL: CP002355.PE358

CP002355.PE358       Location/Qualifiers
FT   CDS_pept        complement(356324..356647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_02386 hypothetical protein; SPTR:
FT                   Binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33026"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ27"
FT                   /protein_id="ADR33026.1"
FT                   /translation="MNTRGTSIRQVALMSFGSDEVEAMESLNTLWVQTMDLKHENALVY
FT                   PLDIMVEHIGELYPLKYIDKDNFSTYEAENGSEWLISKSLHINDIDAFFKVYLHLSDEE
FT                   AAA"
     atgaacacac gcggtacatc tatacgacag gtcgcattaa tgagtttcgg ctcagatgaa        60
     gttgaagcga tggagagttt aaatactcta tgggttcaaa ccatggattt aaaacacgag       120
     aatgctcttg tttatccgtt ggatatcatg gtagaacaca tcggagagct ttaccctctc       180
     aaatatatcg ataaagacaa ctttagcacc tatgaagcgg aaaacggttc tgagtggctt       240
     atttcaaaat cacttcacat caatgatatc gacgcatttt ttaaagtata tctgcatcta       300
     agcgatgaag aagcggcagc ctga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page