(data stored in ACNUC7421 zone)

EMBL: CP002355.PE359

CP002355.PE359       Location/Qualifiers
FT   CDS_pept        complement(356966..358174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0360"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="COGs: COG0771
FT                   UDP-N-acetylmuramoylalanine-D-glutamate ligase; InterPro
FT                   IPR005762: IPR013221: IPR004101: IPR018109; KEGG:
FT                   tdn:Suden_1616 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
FT                   synthetase; PFAM: Mur ligase middle domain protein;
FT                   cytoplasmic peptidoglycan synthetase domain protein; PRIAM:
FT                   UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase; SPTR:
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanine/D-glutamate ligase; PFAM: Mur
FT                   ligase family, glutamate ligase domain; Mur ligase middle
FT                   domain; TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33027"
FT                   /db_xref="GOA:E4TZ28"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ28"
FT                   /protein_id="ADR33027.1"
FT                   /translation="MKNQNIACFGYGKTTRAIAKLLGPCTFFDDKITVPSVDEDGNALK
FT                   PVSEFDTRLFTHEIPSPGFPPSHPLIQKAQHLISEYDFFAPNIPFSIWISGTNGKTTTT
FT                   QMVEHLLADKGSISGGNIGTPLAEMSPDAPIWILETSSFSMHYTDIARPNIYALLPVTP
FT                   DHVSWHGSMQAYYDAKLKPLSMMKEGEAVILPKMFADTPTKAFKIIYEDEKDLAKYFGF
FT                   DANKIKFKGAFLMDAMIAMGIDKILYDRCDYDRINAFVLDPHRQEEFRDSRDRLWINDS
FT                   KATNIDATLAALRTYGSYPIHLVLGGDDKGVELEELFTPLKRYDVSVYAIGSNALRLEA
FT                   LCKQYDIPCTLCHTLDVAVEEISKKHNRHSIAMLSPAAASLDQFTSYAQRGNLFRDLAK
FT                   ATK"
     atgaaaaatc aaaatatcgc ctgtttcggc tacgggaaaa cgacccgtgc catcgccaaa        60
     ctcctcggtc cctgtacttt tttcgacgat aaaattaccg tcccctccgt cgatgaggac       120
     ggcaatgctc tcaaaccggt gagcgaattc gatacccgtc tttttaccca tgagataccc       180
     tcacccggtt ttccgccgtc gcatccgctg attcagaagg ctcagcacct catcagcgaa       240
     tacgatttct tcgctcccaa tatccccttt tcgatctgga tcagcggtac caacggcaaa       300
     acgacgacca cgcagatggt agagcacctt ttggctgaca aaggctctat cagcggcggt       360
     aatatcggaa ctccccttgc cgagatgtct cccgatgccc ccatctggat tttagagacg       420
     agttctttca gtatgcacta taccgatatc gcccgcccga atatttatgc ccttctcccc       480
     gtcacccccg atcatgtgag ttggcacgga agcatgcagg cctattacga cgccaaacta       540
     aagcccctta gtatgatgaa agagggagaa gcggtcattt tgccgaagat gttcgcagat       600
     acccctacaa aagcttttaa aatcatctac gaagatgaaa aggatctcgc taaatacttc       660
     ggattcgatg caaacaaaat caaattcaaa ggggcgttct tgatggatgc catgatcgcg       720
     atggggattg ataaaatcct ttacgaccga tgcgattacg accgtatcaa tgcattcgtc       780
     cttgatcctc accgccaaga ggagtttcgt gactcccgtg accgtctttg gatcaacgat       840
     tccaaagcga ccaatatcga tgcaacgtta gcggcactcc gcacctatgg ctcttatccg       900
     atccatctgg tgctcggagg cgatgacaag ggggtagagc tcgaagagct ttttacccct       960
     cttaaacgct acgacgtcag cgtttatgct atcggaagca atgcgttgcg tctcgaagcg      1020
     ctctgcaagc aatacgatat cccctgtacc ctctgccata cactcgatgt ggcggtagaa      1080
     gagatcagca aaaaacacaa ccgccacagc attgcgatgc tctctccggc tgcggctagt      1140
     ttggatcaat ttacgtcgta tgcacagcgc gggaatctat tccgcgatct tgcaaaagca      1200
     acaaaataa                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page