(data stored in ACNUC7421 zone)

EMBL: CP002355.PE36

CP002355.PE36        Location/Qualifiers
FT   CDS_pept        complement(36087..37664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0036"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089: IPR003660: IPR004010; KEGG:
FT                   nis:NIS_1120 hypothetical protein; PFAM: chemotaxis sensory
FT                   transducer; histidine kinase HAMP region domain protein;
FT                   Cache domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Cache domain; HAMP domain;
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32704"
FT                   /db_xref="GOA:E4TW88"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW88"
FT                   /protein_id="ADR32704.1"
FT                   /translation="MNIFNTIKSKFIVNLVAAVGAILVSVIVAYFIAVGSIKEIMISDL
FT                   NTVADVLEKNVNYIANIEPKAYEETEFKEEIKKIKIGKSGYVYFINAEGVMTIHPKPED
FT                   EGKNKSGHDYVDHIRADKAGGIYEYVSATTGQDKIAAYRYIPAWDMWVIPGINKADYFE
FT                   ELRAGFFKWFLLLGTILTAMLIAINYVSGTSILHPIEELDKVSSDLAHGNGDLTKRLPI
FT                   LNKNDEIGIASLYLNQFITKIQSTINDTKQITSSAVDSTSTLNSAAANLSAQSEKTNTI
FT                   AQNTNKTASEIEVTLEQSVNMAKATLENSRLTETELSHVRDIATAITSEVHKTTQMSSE
FT                   LGERFAQLSSDAASVSGVLSIISDIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRK
FT                   LAERTQKSLTEINSTISIVIQSISDSSDMMHSNSQNISRLAERSEEIDLKIDAASSALR
FT                   SNVDASHQSVQQSENMAQKIHEIIHKVSEMSSLSQSNQEEIKQISNIAVELYNAATNLN
FT                   TQLGQFKS"
     atgaatatct tcaatactat caaatctaag tttatcgtca atcttgtggc agccgtgggc        60
     gcaatccttg taagtgtcat tgtagcatac ttcatcgccg taggatcgat caaagaaatc       120
     atgatcagcg atctcaatac tgtcgccgat gtgctggaaa agaatgttaa ctacattgcc       180
     aatatcgagc ccaaagcgta tgaagaaaca gagtttaaag aggagatcaa aaagatcaaa       240
     atcggtaaaa gcggctatgt ctattttatc aatgccgaag gtgtgatgac gattcatccg       300
     aaaccggaag atgaaggaaa aaacaaatcg gggcatgatt atgtggatca tatccgggcc       360
     gataaagcgg gaggtattta tgagtatgtt tccgctacga cgggacagga taaaattgcc       420
     gcctaccgat atattcccgc atgggatatg tgggtaatcc cgggaatcaa taaagccgat       480
     tatttcgagg aacttcgggc gggctttttt aaatggtttt tactgttggg tactatcctg       540
     accgccatgt tgatcgcgat caattatgtt tccggtacca gtattcttca cccgatcgaa       600
     gagcttgata aagtatcgag tgaccttgct cacggaaacg gcgatttgac caaacgtctg       660
     ccgattctga acaagaacga tgaaatcggg atagcaagcc tttatctcaa tcagtttatc       720
     actaaaatcc aaagtacgat caacgatacc aaacaaatca cctcgtcggc cgtcgactcc       780
     accagtacgc tcaacagtgc ggcggcgaat ctttctgccc aatcggaaaa aaccaatacg       840
     atcgcacaaa ataccaataa gacggcttcc gagattgaag taacgttgga gcaaagcgtc       900
     aatatggcaa aggccaccct agagaacagc cgtttaaccg aaacggaact cagccatgtt       960
     cgtgatattg cgaccgccat aaccagcgaa gtgcataaaa caacgcagat gagcagtgag      1020
     ctcggagaac gtttcgcaca gctctccagc gatgcggcaa gcgtcagcgg agtactcagc      1080
     attatttccg atattgccga tcagaccaat cttctcgcac tcaatgcggc tatcgaagcg      1140
     gcacgtgcag gtgaacacgg gcgcggcttt gccgtcgtcg ccgatgaggt gcgcaaactc      1200
     gccgaacgga cgcaaaaaag cctgacagag atcaactcga cgatctctat cgtcatccag      1260
     tctatttccg attcatcgga catgatgcat tcaaacagcc aaaatatcag ccggcttgcg      1320
     gagcggagtg aagagatcga tctaaaaatc gatgcggcat ccagtgcgct gcgttcaaac      1380
     gtcgacgcca gccatcagag tgttcagcaa tcggagaata tggcacaaaa aattcatgaa      1440
     atcattcata aagtttctga aatgtccagc ctctcccaaa gcaatcagga agagatcaag      1500
     cagatctcca atattgccgt cgaactctac aacgccgcga caaacttgaa tacccaatta      1560
     ggccagttca agtcctaa                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page