(data stored in ACNUC7421 zone)

EMBL: CP002355.PE361

CP002355.PE361       Location/Qualifiers
FT   CDS_pept        359328..360803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0362"
FT                   /product="phosphoglycerate mutase"
FT                   /note="COGs: COG0696 Phosphoglyceromutase; InterPro
FT                   IPR005995: IPR011258: IPR006124; KEGG: tdn:Suden_1614
FT                   phosphoglyceromutase; PFAM: BPG-independent PGAM domain
FT                   protein; metalloenzyme domain protein; PRIAM:
FT                   Phosphoglycerate mutase; SPTR:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: Metalloenzyme
FT                   superfamily; BPG-independent PGAM N-terminus (iPGM_N);
FT                   TIGRFAM: 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33029"
FT                   /db_xref="GOA:E4TZ30"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ30"
FT                   /protein_id="ADR33029.1"
FT                   /translation="MSKKTVLVITDGIGYSPKHDFNAFHAAKKPTYDRLFSEVPHSLID
FT                   TFGLSVGLPEGQMGNSEVGHMSIGSGRVLYQDLVKISLALEEGTFEHNEVFTSLLKTSK
FT                   RLHLIALMSDGGVHSHIDHLIGVSEIAADMGKEVWLHLITDGRDVAPTSAKLFLNTIEA
FT                   HGSANIKIGSLGGRFFAMDRDNRWDRVQKGYEAIMSALPQSEQSVADYIENAYASGETD
FT                   EFITPTSFYGYEGVKEGDAVLMLNFRSDRMRELTTAIGDPEFNGFKRVFVPTHLATVTQ
FT                   YDKSFPYPVLFPKDAPVNTLAEVISKAGLRQLHTAETEKYAHVTFFFNGGIEEPYENET
FT                   RVLIPSPQVKTYDMQPQMSAPEVGSAVVKAMDEGIDFVVVNFANGDMVGHTGNFEAAIS
FT                   AVEAVDHELGRIVEAAQKNGYSMVLTSDHGNCEEMRDDAGNILTNHTVGKVWCFVMAEG
FT                   VSEVHPGALNNVAPTVLKLMELDIPSEMDTPLI"
     ttgagcaaaa aaaccgtttt ggtcattaca gacggcatcg gttactcgcc gaagcatgac        60
     tttaatgctt ttcacgcagc caaaaaaccg acgtatgatc gattgtttag cgaagttccc       120
     cactcactga tcgatacgtt cggtttgagc gtcggtcttc ctgaggggca aatgggcaat       180
     tccgaagtgg ggcatatgtc gatcggaagc ggtcgggtat tgtatcagga tttggtcaaa       240
     atctctcttg cattggaaga ggggacattt gagcacaatg aagtttttac atcactgctt       300
     aaaaccagca aacggcttca tctgattgcc cttatgagcg acggcggagt tcattcgcat       360
     atcgatcatc tgatcggagt ttccgaaatt gcggcggata tgggtaaaga ggtgtggctc       420
     catcttatca ctgacgggcg cgatgtggct cctacatcgg caaaactctt tttaaatacg       480
     atagaagcgc acgggtcggc caatatcaaa atcggatctc tcggagggcg ctttttcgcc       540
     atggatcggg ataaccgatg ggatcgtgtc caaaaaggat acgaggcgat tatgagtgca       600
     ctccctcaaa gcgaacaaag tgttgccgac tatattgaaa atgcgtatgc ttcgggagag       660
     accgatgaat tcattacccc tacatcattc tacgggtatg aaggggtaaa agagggggat       720
     gcggtattga tgctcaattt ccgaagtgac cggatgcgtg aactcacgac ggcgatcggc       780
     gatcctgaat ttaacggatt taagagggtg tttgttccga cccatttggc aacggtaacg       840
     cagtatgaca aatctttccc ttatccggtt cttttcccaa aagatgctcc cgtaaatacc       900
     ttggcggaag tgatctcgaa agcggggctt cgccagctgc atacggcgga aaccgaaaag       960
     tatgcccatg tcaccttttt ctttaacggc ggtatcgaag agccgtatga aaacgagact      1020
     cgggtgctga tcccgagtcc gcaggttaaa acgtatgaca tgcagccgca gatgtctgca      1080
     cccgaagtcg ggagtgccgt ggttaaagca atggatgagg gaatcgattt tgtggtcgtc      1140
     aatttcgcca acggtgatat ggtgggacat accggcaatt ttgaagcggc aatcagcgcc      1200
     gtcgaggcgg ttgatcacga attggggaga atcgtcgaag cggcacaaaa gaacggctat      1260
     tcgatggtat tgacctccga tcacggcaac tgcgaagaga tgcgtgatga tgcgggcaat      1320
     attttaacca accacacggt cggaaaagta tggtgtttcg ttatggctga gggggtgagc      1380
     gaagtacatc cgggtgccct taataatgtc gcaccgacgg ttctaaaatt aatggagctg      1440
     gatattccgt ccgagatgga tacaccgcta atataa                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page