(data stored in ACNUC7421 zone)

EMBL: CP002355.PE362

CP002355.PE362       Location/Qualifiers
FT   CDS_pept        360874..361617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0363"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR011284: IPR002198: IPR002347:
FT                   IPR020904; KEGG: tdn:Suden_1613
FT                   3-ketoacyl-(acyl-carrier-protein) reductase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR:
FT                   3-oxoacyl-[acyl-carrier-protein] reductase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase; PFAM: short
FT                   chain dehydrogenase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33030"
FT                   /db_xref="GOA:E4TZ31"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ31"
FT                   /protein_id="ADR33030.1"
FT                   /translation="MKFSGKNVLVTGSSRGIGAEVAKVLALYGLKVWINYRSGAAAADA
FT                   VKAQIEAAGGQAAVIGFDVADEAAFVDAIKTIIDADGELSYLVNNAGITKDALALRMKS
FT                   DDFMAVINANLLSAFVGCREAFKAMRKQKFGAIVNIASIVGETGNAGQTNYAASKGGVI
FT                   AMTKSFAQEAASSGIRYNTVTPGFIATDMTDVLSEEIKASFTSKIPMGRFGNAAEVAEA
FT                   TAFLLSDHSSYITGETLKVNGGMFM"
     atgaaatttt cgggaaaaaa tgtattggta acaggttcaa gccggggaat cggtgcggaa        60
     gtagcaaaag tgttggctct ctacggtctt aaagtatgga tcaattatcg tagcggtgcg       120
     gcagcggcgg atgcggttaa agcacaaatc gaagcggccg gcgggcaagc ggcggttatc       180
     ggattcgacg tagccgacga agcggcattt gtcgatgcga tcaaaacgat tatcgatgcg       240
     gacggcgaac tctcctattt ggttaataat gcggggatta cgaaagacgc cttggccctt       300
     cgtatgaaga gcgatgattt catggcggtt atcaacgcca atctcctctc cgcattcgtc       360
     ggatgccgcg aagcgtttaa agcaatgcgc aaacaaaaat tcggtgccat cgtcaatatc       420
     gcgtctatcg tcggtgaaac gggaaatgcc ggacagacga actacgcggc ttccaaaggg       480
     ggcgtgatcg caatgaccaa aagttttgct caggaggcgg catcaagcgg tatccgctac       540
     aacacggtta ctccgggctt tatcgcaacg gatatgaccg atgtcctcag cgaagagatc       600
     aaagcctcgt tcacatcaaa aattccgatg ggccgtttcg ggaacgccgc ggaagtggct       660
     gaagcgaccg catttttgct cagcgatcat tccagctaca tcaccggaga aactctcaaa       720
     gtcaacggcg gaatgttcat gtaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page