(data stored in ACNUC7421 zone)

EMBL: CP002355.PE364

CP002355.PE364       Location/Qualifiers
FT   CDS_pept        362041..363258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0365"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="COGs: COG0304 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase; InterProIPR017568: IPR014030: IPR014031:
FT                   IPR017441: IPR 018201; KEGG: tdn:Suden_1609 3-oxoacyl-(acyl
FT                   carrier protein) synthase II; PFAM: Beta-ketoacyl synthase;
FT                   SPTR: 3-oxoacyl-(Acyl-carrier-protein) synthase 2; TIGRFAM:
FT                   3-oxoacyl-[acyl-carrier-protein] synthase 2; PFAM:
FT                   Beta-ketoacyl synthase, N-terminal domain; Beta-ketoacyl
FT                   synthase, C-terminal domain; TIGRFAM:
FT                   beta-ketoacyl-acyl-carrier-protein synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33032"
FT                   /db_xref="GOA:E4TZ33"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ33"
FT                   /protein_id="ADR33032.1"
FT                   /translation="MRRVVVTGMGMINALGHDKESSFKAICDGECGIDMITIFDASTQS
FT                   AQIAGEVKNFDPETVMDAREVKKADRFIHLGIKAAQEAMADANFPEGFDKERFGIDAAA
FT                   GIGGLPSIEKNSIILETKGARRISPFFIPGALVNMLGGFISIDHGLQGPNLSAVTACAA
FT                   GTHAISEAAKTIMVGGADQMLVVAAESAITGVGIGGFASMKALSTRNDDPKHASRPFDA
FT                   DRDGFVMGEGAAALVLEEYDAAVARGARIYAEVIGFGESGDANHITTPSLEGPLRAMKA
FT                   ALKMAGNPKVDYVNAHGTSTPTNDKNETAALKIAFGSKENCPPVSSTKGQTGHCLGAAG
FT                   GIEAVISIMAMRDGIIPPTINYVNPDENCDLDIVPNTARKAELNIVMSNSFGFGGTNGV
FT                   VIFKKI"
     gtgagaagag tagtagtaac cggtatggga atgatcaatg cgcttggtca cgataaagag        60
     agctcattta aagctatttg tgacggtgaa tgcgggattg atatgatcac gatttttgat       120
     gcatcgacac aaagtgctca aattgccggt gaggtaaaaa atttcgatcc tgagaccgtt       180
     atggatgccc gagaggttaa aaaagcggac cgttttattc atcttgggat caaagcggct       240
     caagaagcga tggcggatgc caattttccg gaaggattcg ataaagagcg tttcggtatc       300
     gacgcggcag ccggtatcgg aggacttccg tcgattgaaa aaaattcgat tatccttgaa       360
     accaaaggtg cacgccgtat ctctccattc tttatcccgg gagcattggt aaacatgctc       420
     ggcgggttta tatctatcga tcacggcctt caaggtccta acctatcagc ggtaacggca       480
     tgtgcggcag gaacccatgc gatcagcgaa gcggcaaaaa caattatggt cggcggtgct       540
     gatcaaatgc tggtcgtcgc ggctgaatcg gcgattaccg gtgtcggtat cggcggattt       600
     gcatcaatga aagcgctttc tacccgcaac gatgatccga aacatgcatc acgtccgttc       660
     gatgcggatc gtgacgggtt cgttatgggc gagggggctg ccgcattggt actcgaagag       720
     tacgatgcgg cagtggcgcg cggtgcccgt atttatgcgg aagtcatcgg attcggtgag       780
     agcggtgatg cgaatcacat tacaacacca agtcttgagg ggccgcttcg tgcaatgaaa       840
     gcggcactta aaatggcggg gaatcctaaa gttgactatg tcaatgcgca cggaaccagt       900
     actccgacca acgataaaaa cgaaacggca gcactcaaaa tcgcattcgg aagcaaagag       960
     aactgtcctc cggtgagttc gacaaaaggg caaacggggc actgtctcgg tgcagcgggc      1020
     ggtattgaag cggttatcag tattatggcg atgcgtgacg gtattatccc tccgactatc      1080
     aactacgtca atccggatga aaactgcgat ttggatatcg ttccgaatac ggcacgtaaa      1140
     gcggaactta atatcgttat gtctaactct tttggatttg gcggcaccaa cggtgttgtc      1200
     attttcaaaa aaatataa                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page