(data stored in ACNUC7421 zone)

EMBL: CP002355.PE365

CP002355.PE365       Location/Qualifiers
FT   CDS_pept        363271..364206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0366"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /note="COGs: COG0825 Acetyl-CoA carboxylase alpha subunit;
FT                   InterPro IPR001095: IPR020582: IPR011763; KEGG:
FT                   tdn:Suden_1608 acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha; PFAM: Acetyl-CoA carboxylase, alpha subunit,
FT                   conserved region; PRIAM: Acetyl-CoA carboxylase; SPTR:
FT                   Acetyl-coenzyme A carboxylase carboxyl transferase subunit
FT                   alpha; TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; PFAM: Acetyl co-enzyme A
FT                   carboxylase carboxyltransferase alpha subunit; TIGRFAM:
FT                   acetyl-CoA carboxylase, carboxyl transferase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33033"
FT                   /db_xref="GOA:E4TZ34"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ34"
FT                   /protein_id="ADR33033.1"
FT                   /translation="MATYLDFEQNIRQIQEEIIAAEVRYDHHAVEILKQDLDKEVQKTY
FT                   ANLSPYQELQLARHQDRPYALDYINLILDKKYEIHGDRHFRDDLSIICYIGTIGDERVM
FT                   VIGEQKGRGTKNKLKRNFGMPHPEGYRKALRAAKMAEKFNIPLLMLIDTPGAYPGLGAE
FT                   ERNQSEAIARNLLELSNLNTITVSVVIGEGGSGGALAIGVADRLAMMRYSVFSVISPEG
FT                   CSAILWNDPTKVEAATKALKITSADLKELDLIDDIIDEPLIGAHRDKEGSANALKSYFM
FT                   TQVNTLRKLSDSERLDKRYNRLVGMGRFSE"
     ttggctacct atttagattt tgaacaaaat atccgtcaaa ttcaagagga gatcatagct        60
     gcagaagttc gctacgatca ccatgccgta gagatcctca agcaggattt agataaagag       120
     gttcaaaaaa cctacgcgaa tctttccccg tatcaagagc ttcagctcgc gcgtcatcaa       180
     gaccgtccgt atgcccttga ttatatcaac cttatcctcg ataaaaagta tgaaattcac       240
     ggagatcgtc actttcgaga tgatctctct attatctgct atatcggcac catcggtgat       300
     gaacgggtta tggtgatcgg tgaacaaaaa gggcgcggaa ccaaaaataa gctcaaacga       360
     aacttcggta tgcctcatcc tgaagggtac cgcaaagcac ttcgtgcggc caaaatggcg       420
     gaaaaattca atattcctct tctgatgctg atcgacactc cgggcgccta tccgggtctg       480
     ggtgcggaag agcgtaacca aagcgaagcg attgcccgaa atcttctcga actctcaaac       540
     ctcaatacga ttaccgtatc ggtggtcatc ggcgaggggg gaagcggagg tgctttggcg       600
     atcggtgtag cggatcgcct cgctatgatg cgctactccg tcttcagtgt tatctcacct       660
     gaggggtgtt cggcaatttt gtggaatgac ccgaccaaag tagaagcggc aacgaaagcg       720
     cttaaaatca cctctgccga cctgaaagag cttgatttga tcgatgatat tatcgatgag       780
     ccgctgatcg gtgcacatcg tgataaagag ggctccgcaa acgcccttaa atcatatttt       840
     atgactcagg tcaatacact tcgcaagctg agtgattccg agcgccttga taagcgttac       900
     aaccgtcttg tcggtatggg acgcttcagc gaataa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page