(data stored in ACNUC7421 zone)

EMBL: CP002355.PE37

CP002355.PE37        Location/Qualifiers
FT   CDS_pept        37733..39061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0037"
FT                   /product="Fibronectin-binding A domain protein"
FT                   /note="COGs: COG1293 RNA-binding protein homologous to
FT                   eukaryotic snRNP; InterPro IPR008616: IPR008532; KEGG:
FT                   tdn:Suden_0123 hypothetical protein; PFAM:
FT                   Fibronectin-binding A domain protein; protein of unknown
FT                   function DUF814; SPTR: Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function (DUF814);
FT                   Fibronectin-binding protein A N-terminus (FbpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32705"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW89"
FT                   /protein_id="ADR32705.1"
FT                   /translation="MRFSYLKQIVAYMQQEFSYVVAAYRVNDTTLKLVFNRENSWNFEM
FT                   QRGNSAITIGEIPNRGKMYQAPFDILIAKRLNRSTIQSITLHNNDKIIRITTTTSGSYK
FT                   SETTILQLEFTGKHTNVILLDKEGIVLEALRHIDEDVSARSVRVGQKLGEIPSPPFEPK
FT                   EYPLENVRDYLIEEFRRRNSDKLNQLKHEKKALLQKRLGQLHKHLDALEEEGVLIQDAQ
FT                   ASQNAGHLILANLDVVKPYGKKAELINFDGTPVELELPSGCTTAAGCAESFFKRSKKAK
FT                   QKAQGLHQERSNLEAKIRHLELFIQTVEEATSPEEITLLFPPKAMGSKVKSSDSIAEFW
FT                   IEGVKVSLGKSEKGNIELLRNAKARDIWMHLKDRPSAHVIISTDKQQLPEKLLEAAAKL
FT                   CVDFSVFEKGRYLVDYTPRREVKMGEGANVLYTDYKTLNIEKG"
     atgagatttt cttatttaaa acaaattgtt gcgtatatgc agcaggaatt ttcttacgtt        60
     gtggccgctt acagggttaa cgatactaca ttaaaattgg tttttaatcg tgaaaacagc       120
     tggaattttg agatgcagcg gggaaattcg gctatcacga tcggtgagat tcccaatcgg       180
     gggaaaatgt atcaggcacc gtttgatatt ttgattgcaa agcggctcaa ccgctcaacg       240
     atccaatcga ttactcttca caacaatgat aaaatcatcc gaatcacgac gacgaccagc       300
     ggttcgtata aatcggaaac caccatttta cagctcgaat ttaccggaaa acacaccaat       360
     gtcatacttt tggacaaaga ggggattgtt ttagaagcgc tgcgtcatat cgatgaggat       420
     gtttctgccc gcagtgttcg tgtcgggcaa aaactaggcg aaataccttc tcccccgttt       480
     gaaccgaaag aataccctct cgagaatgtc cgtgactatt tgatcgaaga gtttcgtcga       540
     cgtaacagcg ataaactcaa tcagcttaaa catgaaaaga aagccctttt gcaaaagcgt       600
     ttaggccaat tgcacaaaca tttggacgcg ttggaggaag aaggggtgtt gatacaggat       660
     gcgcaagcgt ctcaaaatgc cggacatttg attctggcca atctggatgt tgtcaaaccg       720
     tatgggaaaa aggccgaatt gattaatttt gacgggactc cggtggaatt ggaacttcct       780
     tcaggatgta caacggcggc aggatgcgcg gagagttttt tcaagcgctc caaaaaagcg       840
     aaacaaaaag cacaggggct tcatcaggaa cgaagcaatc tcgaagccaa aatccgccat       900
     ctggaacttt ttatccaaac ggtagaggag gcaacgtctc ccgaagagat aacgttgctg       960
     ttccccccga aagccatggg atcaaaagtc aaatcgtccg attcgatcgc cgaattttgg      1020
     attgaggggg tcaaggtctc tttgggcaaa agcgagaaag gaaatattga gcttctgcgc      1080
     aatgccaaag cgcgcgatat ttggatgcat ctcaaagatc gtccgtccgc ccacgtgatt      1140
     atctcgaccg acaaacagca gcttcccgaa aaactcctcg aagcggccgc gaaactttgc      1200
     gtcgattttt ccgtatttga aaaagggcgc tatttggtcg attatacccc cagaagagaa      1260
     gtgaaaatgg gggaaggtgc gaatgtcctc tatacggatt ataaaacact gaatatcgaa      1320
     aaagggtaa                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page