(data stored in ACNUC7421 zone)

EMBL: CP002355.PE370

CP002355.PE370       Location/Qualifiers
FT   CDS_pept        complement(367717..368526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0371"
FT                   /product="putative signal transduction protein"
FT                   /note="KEGG: tdn:Suden_1603 putative signal transduction
FT                   protein; SPTR: Putative signal transduction protein; PFAM:
FT                   HDOD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33038"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ39"
FT                   /protein_id="ADR33038.1"
FT                   /translation="MVTQEQITSYIQNIPPAPFVVKQTLDYVRVGDLTKAAKCAEEDPA
FT                   LKFYLKTLVNRPIYGFRNEVSDLAQIFTILGISTAQQILYNYLLSLLAPKEWGLFKLTS
FT                   QEFYDLQASLSRKWVKILTHLNLHNHDTESAITLLPASIIVCDALFGEYKSEVAQLRSV
FT                   KALDYNTILYRLTKMSLFNICTEIGEKWELSPMISRIVHASSGLDQNLEENEKTLAKWM
FT                   HLLLFYELSQNAYVEAGLNEFIEFQIEFVQDIYESFMQVVEYDESDR"
     gtggttactc aagaacaaat tacaagttac atacaaaata taccgccagc tccgtttgtt        60
     gttaaacaaa cactcgatta cgtgcgtgta ggcgatttga ccaaagcggc caaatgtgcc       120
     gaagaagacc ctgctctcaa attttacctc aagaccctag ttaaccgccc tatctacgga       180
     tttcgtaacg aagtaagcga tctggctcag atctttacta ttttgggaat ctcgaccgct       240
     cagcagattt tatataatta cctcctctcc ctcttggccc cgaaagagtg gggacttttt       300
     aaactcactt cgcaagagtt ttatgattta caggctagcc ttagccgaaa atgggtcaaa       360
     attctcaccc acttgaacct gcacaatcat gacaccgaaa gcgctatcac ccttttgccg       420
     gctagtatca tcgtatgtga tgcactgttc ggagaataca aaagcgaagt ggcacagctg       480
     cgaagcgtca aagcgttgga ttacaacacg atcctttatc ggctgaccaa aatgagcttg       540
     tttaatatct gtacggaaat tggcgaaaaa tgggaacttt cgccgatgat cagtcgaatt       600
     gtccatgcat cttccggttt ggatcaaaac cttgaagaaa atgaaaaaac attggcaaaa       660
     tggatgcatt tgctcctttt ttatgaattg agccaaaatg cttatgtcga agcgggactg       720
     aacgaattta tcgagtttca aatcgaattc gttcaggaca tatacgaatc ttttatgcag       780
     gtggtggagt acgatgagag cgaccgttaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page