(data stored in ACNUC7421 zone)

EMBL: CP002355.PE371

CP002355.PE371       Location/Qualifiers
FT   CDS_pept        368688..368876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0372"
FT                   /product="LSU ribosomal protein L28P"
FT                   /note="COGs: COG0227 Ribosomal protein L28; InterPro
FT                   IPR001383; KEGG: ant:Arnit_2237 50S ribosomal protein L28;
FT                   PFAM: ribosomal protein L28; SPTR: 50S ribosomal protein
FT                   L28; TIGRFAM: ribosomal protein L28; PFAM: Ribosomal L28
FT                   family; TIGRFAM: ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33039"
FT                   /db_xref="GOA:E4TZ40"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ40"
FT                   /protein_id="ADR33039.1"
FT                   /translation="MARKCAISGKGPMSGNNVSHAKNRTKRRFLPNLRTVRVTLEDGTT
FT                   KKLKIAASELRTLKKDS"
     atggcaagaa aatgtgctat tagtggtaaa ggcccaatga gcgggaacaa cgtttctcac        60
     gcgaaaaata gaactaagcg tcgtttttta ccaaaccttc gtactgttcg cgtaacgctt       120
     gaagacggta ctaccaaaaa acttaaaatc gctgcttctg agcttcgtac tcttaaaaaa       180
     gattcgtaa                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page