(data stored in ACNUC7421 zone)

EMBL: CP002355.PE374

CP002355.PE374       Location/Qualifiers
FT   CDS_pept        371417..373207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0375"
FT                   /product="GTP-binding protein LepA"
FT                   /note="COGs: COG0481 Membrane GTPase LepA;
FT                   InterProIPR005225: IPR006297: IPR000795: IPR004161: IPR
FT                   000640: IPR013842; KEGG: tdn:Suden_1637 GTP-binding protein
FT                   LepA; PFAM: GTP-binding protein LepA domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; elongation factor G domain-containing
FT                   protein; SPTR: GTP-binding protein lepA; TIGRFAM:
FT                   GTP-binding protein LepA; small GTP-binding protein; PFAM:
FT                   Elongation factor Tu domain 2; Elongation factor G
FT                   C-terminus; Elongation factor Tu GTP binding domain;
FT                   GTP-binding protein LepA C-terminus; TIGRFAM: GTP-binding
FT                   protein LepA; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33042"
FT                   /db_xref="GOA:E4TZ43"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ43"
FT                   /protein_id="ADR33042.1"
FT                   /translation="MDNIRNFSIIAHIDHGKSTLADRIIQECGAVSDRELTKQMMDTMD
FT                   IEQERGITIKAQSVRLDYVKDGKHYILNLIDTPGHVDFSYEVSKSLASSDGALLIVDAA
FT                   QGVEAQTIANVYMAMENNLTLIPVINKIDLPAAEPERVAEEIETTIGIDATDAVMISAK
FT                   TGVGIRELIDAIVDRIPAPVGDPSATTKAIIYDSWFDSYQGAMALVRVFDGEIKTGQMV
FT                   KLMHNNENHQVLELLYPHPLRRQKTQSIKSGEIGIVILGVKEVGSIRVGDTITDARNPA
FT                   KEPVGEYAPAKPFVFAGIYPIDTDEFESVRDALDKLKLNDSSLSYEPETSIALGFGFRV
FT                   GFLGMLHMEVVKERLEREFNLDLIATAPSVVYKVYKTDGTMVEVQNPSELPEPQNIERI
FT                   EEPYVRATVIVPTDYLGNVITLLTAKRGMQEKMEYLNETRVMLIYVMPMNEIVVDFYDK
FT                   LKSTSKGYASFDYDPIEFRQGDLVKLDVRVAGDVVDALSVIVPRSSAESRGRALVTNMK
FT                   EIVPRQLFEVAIQASIGNRVIARETVKSMGKNVTAKCYGGDISRKRKLLDKQKEGKKRM
FT                   KAIGKVQLPQEAFMSVLKMD"
     atggataata ttcgtaactt ttcaattatc gcccatatcg accacggcaa aagtacgtta        60
     gccgatcgga ttattcaaga gtgcggagcg gtcagtgacc gtgaactcac caaacagatg       120
     atggacacga tggacatcga gcaagagcgc ggaatcacga tcaaagccca aagtgtccgt       180
     ctcgattacg tcaaagacgg caagcactat atcctcaatc ttattgacac tccgggccac       240
     gttgacttca gttacgaagt ctccaagtcg ctcgcttcga gtgacggcgc attactgatc       300
     gtcgatgcgg cacaaggggt tgaagcgcaa acgattgcca acgtctatat ggcgatggaa       360
     aacaatctga ccctcatacc cgttatcaat aaaatcgatc ttcctgccgc cgaacccgaa       420
     cgggtcgccg aagagatcga aacgacgatc ggtatcgatg cgaccgatgc ggtaatgatt       480
     tcagcaaaaa ccggtgtggg aatccgtgag ttgatcgatg cgatcgtcga tcgtataccg       540
     gcccctgtag gtgacccgag tgcgacgacc aaggcaatta tttacgattc ttggtttgat       600
     tcgtaccaag gggcaatggc gttggtgcgc gtgtttgacg gtgagatcaa gacagggcag       660
     atggtcaagc tgatgcacaa caatgaaaac catcaagtgc tggagctgct ctatcctcat       720
     cctttgcgcc gtcaaaaaac gcaaagtatc aaaagcggcg agatcgggat tgtgattctg       780
     ggtgtcaaag aggtaggaag tatccgtgtc ggcgatacga tcaccgatgc acgtaacccg       840
     gccaaagagc cggttggcga atacgccccg gccaaaccgt tcgtatttgc ggggatctat       900
     ccgatcgata ccgatgagtt tgaatcggtc cgcgatgcgc tcgataagct caagctcaac       960
     gacagcagcc tcagttacga gccggaaaca tcgattgccc tcggattcgg gttccgtgtc      1020
     ggatttttgg ggatgctcca tatggaggtc gttaaagagc ggttagagcg tgaatttaat      1080
     ctcgatttga tcgcgaccgc cccttcggtt gtttataaag tctataaaac cgacggcact      1140
     atggtggaag ttcaaaatcc gagcgaattg cccgaacctc agaacatcga gcggatcgaa      1200
     gagccttatg ttcgtgcaac ggtcatcgtc ccgaccgatt atttgggcaa tgtcattacc      1260
     ctcttgaccg ccaagcgcgg gatgcaggag aagatggaat atctcaacga gacgcgggtc      1320
     atgctgatct acgtcatgcc gatgaacgaa atcgtcgtcg atttttacga caaactcaaa      1380
     tcaacctcta aagggtatgc gagtttcgat tacgatccga tcgaatttcg tcaaggcgat      1440
     ttggtcaaac tcgatgtccg cgtagccgga gatgtcgtcg atgcgctcag cgttatcgtt      1500
     cctcgaagca gtgcggagtc acgcgggcgg gcactcgtga cgaacatgaa agagattgtt      1560
     ccacgccagc ttttcgaagt ggcgattcaa gcctctatcg gaaatcgcgt tattgcccgt      1620
     gaaacggtca aatcgatggg gaaaaacgtt accgccaaat gttacggcgg ggatatctcc      1680
     cgtaaacgca aactcctcga caagcaaaaa gaggggaaaa aacggatgaa ggcgatcggg      1740
     aaggttcagc ttccccaaga agcgttcatg tccgtcctca aaatggatta a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page