(data stored in ACNUC7421 zone)

EMBL: CP002355.PE375

CP002355.PE375       Location/Qualifiers
FT   CDS_pept        373209..373784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0376"
FT                   /product="phosphoribosyltransferase"
FT                   /note="COGs: COG1040 amidophosphoribosyltransferase;
FT                   InterPro IPR000836; KEGG: tdn:Suden_1638 transformation
FT                   system protein; PFAM: phosphoribosyltransferase; SPTR:
FT                   Transformation system protein; PFAM: Phosphoribosyl
FT                   transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33043"
FT                   /db_xref="GOA:E4TZ44"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ44"
FT                   /protein_id="ADR33043.1"
FT                   /translation="MRCMICERFSLSHICSSCQSSLLTPILHKRKILGSIPVYSFYPYN
FT                   EIEPLLLTKHTDLGYYIYTILAKRSLGAFAREWQYENTVASVGIDDRSESGYSHTAVLN
FT                   RALKSNNIVPQYGKLRASQHYKYAGKSVEDRLMNPRRFIYTPFSENEVILVDDIVTTGT
FT                   TLSEAAEVLHTQGKKVILCLTLSDAENK"
     atgcgctgca tgatatgtga gcgcttcagc ctctcgcata tctgctcttc ttgtcaaagc        60
     tctctcctta ctccgatcct tcataaacga aaaatcctgg gttcgattcc cgtctactct       120
     ttttatccct ataatgaaat cgaacctctg ctgcttacca aacataccga tttgggatac       180
     tacatctaca cgatattggc aaagcgttcg ctcggtgctt ttgcccgtga atggcagtat       240
     gaaaacaccg tcgcctctgt cgggatagat gatcgttcag agagcggcta ctcgcatacc       300
     gccgtattga accgtgcatt gaaatcgaat aatattgtcc cgcagtacgg caaacttcgc       360
     gcttcgcagc actataaata tgcgggaaaa agtgtcgaag ataggctgat gaatccaagg       420
     cggtttattt ataccccctt ttcggaaaat gaggtgattt tggtggacga tatcgtcacg       480
     acgggaacaa cgctctctga agcggccgaa gttctccata cgcagggaaa aaaagtgatc       540
     ctctgtctca cccttagcga tgcggagaat aaatag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page