(data stored in ACNUC7421 zone)

EMBL: CP002355.PE376

CP002355.PE376       Location/Qualifiers
FT   CDS_pept        complement(373785..375278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pin:Ping_2350 hypothetical protein; SPTR:
FT                   Nitroreductase; PFAM: Nitroreductase family; TIGRFAM:
FT                   SagB-type dehydrogenase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33044"
FT                   /db_xref="GOA:E4TZ45"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ45"
FT                   /protein_id="ADR33044.1"
FT                   /translation="MKNVSSVLEYHDRTKHRPSRYAASLGYMDWETQPNPFRRYENAPL
FT                   IPLPFSEATPPYHLLFQPDSLPYAPLCIESLAQLLRYALGLAAIKSHGGSEWALRCNAS
FT                   SGNLHPSECYIIAPPLKGLSDSPTLSHYAPRKHALELLHTYREPIGEETLLIALSSVIW
FT                   REAWKYGERCWRYCQLDAGHAAESIRISAAMLGWECSVLSIDTADIASLCGLDQLHRYD
FT                   PNERESPDMLLQIRKGSFTLPKTPELLYNANRLSHSHHLWPILEIIDTATQGEYPRPVI
FT                   MKESRHTPSPTKSSGEIVLKRRSAQMMDGLGITLEQFRQLLDASLFCRDASDVNLVIFV
FT                   HRVEGLEKGLYAYIRDLKELLSLQNSMDSTFEWAEFTEGLYRLRSGDYRGAAQMVSCNQ
FT                   EIAKDGAFSFGMLCNFSSSLERHGAIGYKNLFHQCGMIGQMLYLEATSLGLSATGIGCF
FT                   LDDEFHALLGLRDQKYQSLYHFTIGRAIVDTRITSRQPY"
     atgaaaaatg tatcctccgt actcgaatat cacgaccgaa ccaaacaccg accctcacgt        60
     tatgccgcca gcctcggcta tatggattgg gaaactcagc caaatccttt tcggcgttat       120
     gagaatgccc ctctaatacc tttgcccttt agcgaagcga ccccgccgta tcatctgttg       180
     ttccaacctg attcgctccc ctatgcccct ttgtgcatcg aatcgcttgc gcaattgctg       240
     cgctacgctc tcggactcgc cgccatcaaa agccacggcg gatcggaatg ggcgcttcgg       300
     tgcaatgcca gcagcggaaa ccttcatccc agcgaatgct atattattgc tcccccgttg       360
     aaaggtctga gcgattctcc tacccttagc cactatgcgc cgcgtaaaca tgcactggag       420
     ctgctgcata cttaccgtga acctatcggc gaggagacac ttctcattgc tttaagttcg       480
     gtcatctgga gagaagcgtg gaaatacggg gaacggtgct ggcgctattg ccagcttgat       540
     gcggggcatg ccgccgaatc gatccgtatt tcggcggcga tgctggggtg ggagtgcagt       600
     gttcttagca tcgacacggc cgatatcgcc tcactgtgcg gtctggatca gcttcaccgt       660
     tatgatccga atgagagaga aagccccgat atgttgcttc aaatccgtaa aggttcattc       720
     acccttccca aaacccccga actgctttat aacgcaaacc gtctcagtca ctcccatcat       780
     ctatggccga tactggagat catcgatacg gcgacgcaag gagagtatcc tcgtcccgtg       840
     ataatgaaag agtcccgtca tactccatca ccgacaaaaa gttccggaga gatcgtccta       900
     aaacgccgaa gcgcacagat gatggacggc ttgggtatca ctttagagca gtttcggcag       960
     cttctggatg cttccctctt ctgccgcgac gcctcggacg ttaatcttgt tatttttgtc      1020
     catcgggtcg aagggttaga aaaagggctc tatgcctata ttcgcgatct aaaagagttg      1080
     ctttcacttc aaaacagtat ggactcgacc tttgaatggg ccgagtttac tgaggggctt      1140
     tatcgactac gaagcggtga ttatcgggga gcggcccaaa tggtctcctg caatcaggag      1200
     atcgccaaag acggcgcctt tagtttcgga atgctctgca atttttcaag ctcgcttgaa      1260
     cgtcacggag cgatcggata taaaaacctt tttcaccaat gcggaatgat cggccaaatg      1320
     ctctatcttg aagcgacctc gctgggtctg agcgcaacgg ggatcggatg ttttttagac      1380
     gatgagtttc atgcgttatt ggggttgaga gatcagaaat accaatcctt gtaccacttt      1440
     acgatcggac gcgctatcgt cgatacccga atcacgtcac gccagcccta ttga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page