(data stored in ACNUC7421 zone)

EMBL: CP002355.PE377

CP002355.PE377       Location/Qualifiers
FT   CDS_pept        complement(375326..376573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1642 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33045"
FT                   /db_xref="GOA:E4TZ46"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ46"
FT                   /protein_id="ADR33045.1"
FT                   /translation="MKRIRYFHHTLIGKIFFSFLGVILAAAAVIFSPWGNRLTAPLIEK
FT                   SLTSAFSTPITLQEYGLTPNQFQLLFQDQYGNTFSTQGGFSLLTLRMYAHYRLSCFQHG
FT                   GINPLFSPFKTEGSLSGGIASLLIQGNGDMFGGDLIYKIELHRFHLASLNLKADKIAYT
FT                   PLMQLLKYPSDTDTLLTGGIDLRGFDQRYVEGSILLNSKTRRFNPTPIAKDNNESVTLK
FT                   SLLADKYGDVKPFNVKVTINTSLDHAGILEQFVGMPLGGALELNATLTGDQKLLRLKGN
FT                   SDVARSDTSISLTIADLEPSKLSFDCKHADLEQTFKLFALTPPISGSGDLYGELNTTGG
FT                   SVNVIITEASTVPKVLFQEYQITQPLIRFDAEVHADLSKKGVHYRGSFQSDLSRMETDN
FT                   TTTHEQMLRDLLKSLH"
     atgaaacgta tccgctattt tcaccatacc ctgatcggaa aaatcttttt ctcctttttg        60
     ggagttattc tggcagccgc agccgttatt ttttcaccgt gggggaaccg ccttacggcc       120
     cctttaatcg aaaaatcact tacttccgcc ttctcaacgc cgatcacact ccaagaatac       180
     gggttaaccc ctaatcagtt tcagctcctt ttccaggatc aatacggtaa cacgttttca       240
     actcaggggg gattttctct tctgacgctt cggatgtatg cccattaccg actctcctgt       300
     tttcagcacg gcggcatcaa ccctcttttt tcccctttta aaacagaagg ctctctcagc       360
     ggaggcatcg cctctttgct cattcaagga aacggagata tgttcggcgg agatctcatt       420
     tataaaatcg aactccatcg gtttcatctc gcatctctca atctaaaagc ggacaaaata       480
     gcctatacgc ctcttatgca gctgctcaag tatccatccg acaccgatac cctcctcacc       540
     ggggggatcg atctacgcgg atttgatcag cgctacgttg agggatcgat ccttctaaat       600
     tccaaaaccc gccgttttaa tcctacccct atcgcaaaag acaataacga atcggtaacg       660
     cttaaatcgc tattggccga caaatacggc gatgtcaaac cttttaacgt taaggtcacc       720
     attaatactt ctctggatca tgcgggaatt ttggaacagt ttgtcggtat gccgcttgga       780
     ggagcccttg aattaaacgc gacacttacg ggtgatcaga aactgcttcg gctgaaaggc       840
     aattccgatg tcgcccgaag cgatacttcg atttcactca ctatcgcgga tttggaaccc       900
     tcaaaattat cttttgactg taaacacgcc gatttggaac agacttttaa actctttgcc       960
     cttacccctc cgatatcagg aagcggtgat ttgtacggag agctaaacac cacaggagga      1020
     agtgtaaacg tcatcattac cgaagcttct accgttccga aggtgttatt ccaagaatac      1080
     caaattaccc agcccctgat ccgtttcgat gcggaagtgc atgccgacct cagcaaaaaa      1140
     ggggttcatt acagaggatc gttccaatcc gatttaagcc gcatggaaac cgataatacg      1200
     acgacgcatg agcaaatgct tcgggatcta ttaaaaagct tacactaa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page