(data stored in ACNUC7421 zone)

EMBL: CP002355.PE379

CP002355.PE379       Location/Qualifiers
FT   CDS_pept        378140..378679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0380"
FT                   /product="GrpE protein"
FT                   /note="COGs: COG0576 Molecular chaperone GrpE (heat shock
FT                   protein); InterPro IPR000740; KEGG: tdn:Suden_1643 GrpE
FT                   protein; PFAM: GrpE protein; SPTR: Protein grpE; PFAM:
FT                   GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33047"
FT                   /db_xref="GOA:E4TZ48"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ48"
FT                   /protein_id="ADR33047.1"
FT                   /translation="MSNEVNEDVISDEQTSQNTGEEVIAESMNELETIQAELASFKDKY
FT                   ARVHADFDNIKKRLEREKYQALEYANEKFAKDLIPVVDSLGMAIGAAEIEAEPAVLLEK
FT                   LKEGVELTMKQLLGVLEKHGVTPVDESEPFDPNIHNAVQRVDSPDHESGAIVNTFQKGF
FT                   RYKERTLRDAMVVIAN"
     atgtctaacg aagtaaatga agacgtgatc agcgacgagc aaacatccca aaatacgggt        60
     gaagaggtca ttgctgagag catgaacgaa ttagaaacta ttcaggcgga attggcgtct       120
     tttaaagata agtacgctcg cgtacatgcc gattttgata atattaaaaa acgtctcgag       180
     cgggagaaat accaagcgct ggagtatgca aacgaaaaat ttgccaaaga tctcattccg       240
     gtagtcgatt cgctaggaat ggcgatcgga gcggcagaga tcgaagcaga acctgcggtc       300
     cttttagaga agctcaaaga gggtgttgaa cttacgatga aacagcttct cggtgttctc       360
     gaaaaacacg gtgtaactcc ggtagatgaa tccgagccgt tcgatccgaa tatccataat       420
     gcggtacagc gtgtggacag tccggatcat gagagcggcg caatcgtgaa tacttttcaa       480
     aaagggtttc gatacaaaga acgcactctt agagatgcga tggttgtaat cgccaattga       540
//

If you have problems or comments...

PBIL Back to PBIL home page