(data stored in ACNUC7421 zone)

EMBL: CP002355.PE38

CP002355.PE38        Location/Qualifiers
FT   CDS_pept        39073..39381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0124 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32706"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW90"
FT                   /protein_id="ADR32706.1"
FT                   /translation="MADIGPIGGAIYVNQQMASVASEKNAVLNRFELQALAAASASQEA
FT                   KKEIEEVRPTEENQGVDPDREHTKEQAEQEERRSEHNEKNEENEKPLKPLHLLDIKV"
     atggcagata tcggtccgat cggcggtgca atttacgtca atcagcaaat ggcaagtgtc        60
     gcgagtgaga aaaatgctgt cttaaaccga ttcgaattgc aagctcttgc cgccgcatcc       120
     gcttcccagg aggcaaaaaa ggagatcgaa gaggttcgtc ctaccgaaga gaatcagggg       180
     gttgatcctg accgagaaca taccaaagaa caggcggaac aagaagagag acgttccgag       240
     cacaacgaaa aaaatgagga aaatgaaaaa cctttgaaac ctttgcatct tttagatatt       300
     aaagtttag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page