(data stored in ACNUC7421 zone)

EMBL: CP002355.PE380

CP002355.PE380       Location/Qualifiers
FT   CDS_pept        378801..380678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0381"
FT                   /product="chaperone protein DnaK"
FT                   /note="COGs: COG0443 Molecular chaperone; InterPro
FT                   IPR012725: IPR013126: IPR001023: IPR018181; KEGG:
FT                   tdn:Suden_1644 molecular chaperone DnaK; PFAM: Heat shock
FT                   protein 70; SPTR: Chaperone protein dnaK; TIGRFAM:
FT                   chaperone protein DnaK; PFAM: Hsp70 protein; TIGRFAM:
FT                   chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33048"
FT                   /db_xref="GOA:E4TZ49"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ49"
FT                   /protein_id="ADR33048.1"
FT                   /translation="MSKVIGIDLGTTNSCVAVYEGGEAKIIPNKEGKNTTPSVVAFTDK
FT                   GEILVGDPAKRQAITNPDKTIYSVKRIMGLMMNEEKAKEAHDKVTYKIVDKNGMAAVDV
FT                   AGKVYTPQEISAKILSKLKADAESYLGQSVTDAVITVPAYFNDAQRKATKEAGTIAGLN
FT                   VLRIINEPTASALAYGLDSKGDEKVLVYDLGGGTFDVTVLEISEGTFEVLSTDGNAFLG
FT                   GDDFDNKIVDFLASEFKSDHGIDLKADKMALQRLKDAAENAKKELSSAEETEINLPFIT
FT                   ADATGPKHLVVKLTRAKFEGMIDTLVKETISHIKTAMKDAGLSKNEINEIIMVGGSTRL
FT                   PIAQKMVSDEFGGKTLNKGVNPDEVVAAGAAIQGGVLRGDVKDVLLLDVTPLSLGIETL
FT                   GGIATKIIEKGTTIPVKKSQVFSTAEDNQPAVSISVVQGEREFARDNKSLGLFELNGIP
FT                   AAPRGVPQIEVTFDIDANGILTVSSTDKGTGKSQSITISGSSGLSEEEINKMVQDAENH
FT                   KAEDAKRKEIVDLRNQADALASQTEKSLKEMEDKIDASEKAAIESALEELKAVLKNTDA
FT                   SKEEIEAATKKLADASHKMAEQMYKQNEGGEAASSSAKKDDDVIDAEIE"
     atgtcaaaag ttattggtat cgatttagga acaacaaact catgtgttgc tgtctatgag        60
     ggcggcgaag cgaaaattat cccgaataaa gagggaaaaa atacaactcc ttccgttgta       120
     gcgtttacgg acaaaggtga aattcttgtc ggtgatcctg caaaacgtca ggcgatcaca       180
     aacccggata aaacgatcta ctcggtcaaa cgtatcatgg gtctcatgat gaacgaagag       240
     aaagcgaaag aggcgcacga taaagttacc tataaaattg ttgataaaaa cggtatggct       300
     gcggttgacg tagcgggtaa agtgtatacc cctcaagaaa tctctgcgaa aatcctctct       360
     aaactcaaag cagatgcaga gtcatacttg ggtcaatcag taaccgacgc agttatcacc       420
     gttccggcgt acttcaatga tgctcaacgt aaagcgacga aagaggcggg aaccattgct       480
     gggttgaacg tccttcgtat catcaatgag ccgacagcgt ctgcattggc atacggtttg       540
     gattcaaaag gggatgaaaa agttctcgtt tacgatctcg ggggcggaac attcgacgtt       600
     accgttttgg aaatctctga aggtacgttt gaagttcttt caaccgatgg gaatgcgttc       660
     ctcggtgggg atgacttcga taataaaatc gttgatttcc tagcatctga gttcaaatcc       720
     gatcacggta tcgatttgaa agcggacaaa atggcgcttc aacgtcttaa agacgcggca       780
     gaaaatgcga aaaaagagct ctcttctgcg gaagagacag agatcaacct tccgtttatc       840
     acggcagacg cgaccggtcc taaacacttg gttgttaaat tgacccgtgc aaaatttgaa       900
     gggatgatcg atacgctcgt aaaagagacg atcagccaca tcaaaacagc gatgaaagat       960
     gccggcctta gcaaaaacga gatcaacgaa atcattatgg tcgggggttc aacacgtctt      1020
     ccgatcgcac aaaaaatggt ttcagatgag ttcggcggca aaaccctcaa caaaggggta      1080
     aacccggatg aggtcgtagc agcgggtgcg gcgatccaag gtggggtatt acgcggagat      1140
     gttaaagacg tccttttgct tgacgttaca ccgttgtcac tcggaatcga aacgctcggc      1200
     ggtatcgcta caaaaattat cgaaaaaggg accactattc cggttaaaaa atcgcaagtg      1260
     ttctcgactg cggaagataa ccaacctgcg gtttctatct cggttgttca aggtgagcgt      1320
     gagtttgccc gcgataacaa atctctcggt ttgtttgaac ttaacggtat ccctgcggca      1380
     ccgcgcggtg tacctcaaat cgaggtaacc tttgacatcg atgcgaacgg tatcttgacc      1440
     gttagctcga ccgacaaagg aaccggtaaa tctcaatcga ttacgatttc aggaagttca      1500
     ggactttcag aagaagagat caacaaaatg gttcaagacg ctgaaaacca caaagccgaa      1560
     gatgcgaaac gcaaagagat cgtagatctt cgcaaccaag cggacgcttt ggcgagccaa      1620
     actgaaaaat ctctcaaaga gatggaagat aaaattgacg catcagagaa agcggcgatc      1680
     gaatcggctc tggaagagct taaagcggtt ctcaaaaata ccgatgcgtc taaagaagag      1740
     atcgaagcgg ctacgaaaaa attggccgat gcgagccaca aaatggctga gcaaatgtac      1800
     aaacaaaacg aaggcggcga agcagcctct tcttctgcga aaaaagatga cgacgtcatc      1860
     gacgctgaaa tcgagtaa                                                    1878
//

If you have problems or comments...

PBIL Back to PBIL home page