(data stored in ACNUC7421 zone)

EMBL: CP002355.PE381

CP002355.PE381       Location/Qualifiers
FT   CDS_pept        380783..381079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0382"
FT                   /product="plasmid maintenance system killer"
FT                   /note="COGs: COG3549 Plasmid maintenance system killer
FT                   protein; InterPro IPR007711; KEGG: cja:CJA_3612 plasmid
FT                   maintenance system killer protein; PFAM: plasmid
FT                   maintenance system killer; SPTR: Plasmid maintenance system
FT                   killer protein; PFAM: Plasmid maintenance system killer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33049"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ50"
FT                   /protein_id="ADR33049.1"
FT                   /translation="MIISFADQATSDIFNGIESKQARKALPMELWKSASRKLDQIDSVI
FT                   MLDELKVPPGNRLEKLRGSRENQMSIRINDQYRICFTWSDTGAVNVEITDYHS"
     atgataattt cgtttgcgga tcaagctaca tcggatatat ttaacggcat agagagcaaa        60
     caagctcgta aagctcttcc gatggaacta tggaaaagtg catctcgaaa acttgatcag       120
     atcgattcgg tcatcatgtt ggatgaatta aaggttcccc ccggaaatcg tctcgaaaaa       180
     ctgcgcggga gcagagaaaa tcaaatgagt atccgtatca acgatcagta ccgtatctgt       240
     tttacatgga gtgacacggg tgcggtaaat gtagaaataa ccgattatca ctcataa          297
//

If you have problems or comments...

PBIL Back to PBIL home page