(data stored in ACNUC7421 zone)

EMBL: CP002355.PE384

CP002355.PE384       Location/Qualifiers
FT   CDS_pept        382630..383202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0385"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1124 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro IPR003439:
FT                   IPR003593; KEGG: tdn:Suden_0485 ABC transporter-related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: ABC transporter-related protein; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33052"
FT                   /db_xref="GOA:E4TZ53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ53"
FT                   /protein_id="ADR33052.1"
FT                   /translation="MNTVLDIENISFGYTKDILLFDNFSLSLKAGEIKAIVGPSGVGKS
FT                   TLFELILGHRKPLSGFIRSSSFSQVFQDPYSSFHPTYTVREQIKEVTSMEGYELLLEKM
FT                   GLEEAFLDSLPHKLSGGQLQRCSILRALLMKPKLLLLDEPTSALDNLNQLDIMKLIVDN
FT                   LEGMGVLLITHDGDLAAWCADEIVTLS"
     ttgaacaccg ttttagatat tgaaaatata tcttttggat atactaaaga tatattatta        60
     ttcgataact tttcactctc tcttaaggcg ggggagataa aagcgatagt gggaccgagc       120
     ggtgtcggaa aatcgacgct gtttgaactc attttaggac atcgtaaacc cttatcgggc       180
     tttatccgat catcatcctt ctctcaggtc tttcaagacc cctacagctc gtttcacccc       240
     acctacaccg tgcgtgaaca gatcaaagaa gtaacgtcga tggaagggta tgaattgttg       300
     ctggaaaaga tggggctgga agaggctttt ttggattccc ttccccataa actctcgggc       360
     ggtcagctgc agcggtgctc tatattacgg gcgttgctga tgaagccgaa actgcttctt       420
     ttagacgagc cgacttcggc actggataat ctaaaccaac tcgatattat gaaactgatt       480
     gtggataatc ttgaggggat gggggtactg ctgatcaccc atgacggaga tctggcagct       540
     tggtgcgccg atgagattgt gacgcttagc tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page